Urokinase

Specification

• Cat#: THP-0021
• Product Name: Urokinase
• Cas No: 9039-53-6
• Description: A low molecular weight form of human urokinase, an endogenous peptide that is cleaved in the presence of plasmin between lysine 158 and isoleucine 159 to yield active urokinase. Urokinase remains connected between these 2 chains by a sulfhydryl bond.
• Sequences: KPSSPPEELKFQCGQKTLRPRFKIIGGEFTTIENQPWFAAIYRRHRGGSVTYVCGGSLMSPCWVISATHCFIDYPKKEDYIVYLGRSRLNSNTQGEMKFEVENLILHKDYSADTLAHHNDIALLKIRSKEGRCAQPSRTIQTICLPSMYNDPQFGTSCEITGFGKENSTDYLYPEQLKMTVVKLISHRECQQPHYYGSEVTTKMLCAADPQWKTDSCQGDSGGPLVCSLQGRMTLTGIVSWGRGCALKDKPGVYTRVSHFLPWIRSHTKEENGLAL
• Species: Human
• Molecular Weight: 31126.5 Da
• Formula: C1376H2145N383O406S18
• Endotoxin: <0.001 EU per 1 μg by the LAL method
• Biological Activity: 250KU/5ml
• Application: The product can be used for the treatment of pulminary embolism, coronary artery thrombosis, IV catheter clearance, and venous and arterial blood clots.

Pharmaceutical Information

• Pharmaceutical Application: Urokinase
• Targets: Target 1. Plasminogen; Target 2. Urokinase plasminogen activator surface receptor; Target 3. Urokinase-type plasminogen activator; Target 4. Tissue-type plasminogen activator; Target 5. Plasminogen activator inhibitor 1; Target 6. Plasminogen activator inhibitor 2; Target 7. Plasma serine protease inhibitor; Target 8. Low-density lipoprotein receptor-related protein 2; Target 9. Suppressor of tumorigenicity 14 protein; Target 10. Nidogen-1