0
Inquiry Basket
Quote

Sotatercept

Cat# : THP-0319

Product Datasheets COA :
Catalog# Product Name Availability Size Price Qty
THP-0319 Sotatercept April 14, 2024 10ug $298.00
100ug $1,598.00
1mg $3,998.00
Add to Cart Online Order Request a Bulk Order
Cat#:  THP-0319
Product Name:  Sotatercept
Description:  Sotatercept (ACE-011) is a recombinant fusion protein consisting of the extracellular domain of the human activin receptor type IIA linked to the Fc piece of human IgG1.
Sequences:  ILGRSETQECLFFNANWEKDRTNQTGVEPCYGDKDKRRHCFATWKNISGSIEIVKQGCWLDDINCYDRTDCVEKKDSPEVYFCCCEGNMCNEKFSYFPEMEVTQPTSNPVTPKPPTGGGTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPVPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
Species:  Human
Molecular Weight:  77829.47 Da
Cas No:  1001080-50-7
Formula:  C3448H5264N920O1058S42
Endotoxin Level:  <0.1 EU per 1 μg of the peptide by the LAL method
Publication:  Antibody-based strategies for the detection of Luspatercept (ACE-536) in human serum (Reichel, C., Gmeiner, G., & Thevis, M.) (Drug Testing and Analysis) (2017).
Detection of Sotatercept (ACE-011) in human serum by SAR-PAGE and western single blotting (Reichel, C., Farmer, L., Gmeiner, G.,et al.) (Drug Testing and Analysis) (2017).
Testing for the erythropoiesis-stimulating agent Sotatercept/ACE-011 (ActRIIA-Fc) in serum by means of Western blotting and LC-HRMS (Walpurgis, K., Thomas, A., Vogel, M.,et al.) (Drug Testing and Analysis) (2016).
For research use only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.

Online Inquiry

  • Size: 100ug 500ug 1mg 5mg 10mg 100mg 500mg 1g
  • Conjugation: None R-PE APC Biotin FITC Alexa Flour Others
CONTACT US

For more information on how our products could help advance your project, please contact us.

Contact Us

ENTER YOUR EMAIL HERE TO SUBSCRIBE.

Copyright © 2024 Creative BioMart. All Rights Reserved.