Sotatercept

Specification

• Cat#: THP-0319
• Product Name: Sotatercept
• Cas No: 1001080-50-7
• Description: Sotatercept (ACE-011) is a recombinant fusion protein consisting of the extracellular domain of the human activin receptor type IIA linked to the Fc piece of human IgG1.
• Sequences: ILGRSETQECLFFNANWEKDRTNQTGVEPCYGDKDKRRHCFATWKNISGSIEIVKQGCWLDDINCYDRTDCVEKKDSPEVYFCCCEGNMCNEKFSYFPEMEVTQPTSNPVTPKPPTGGGTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPVPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
• Species: Human
• Molecular Weight: 77829.47 Da
• Formula: C3448H5264N920O1058S42
• Endotoxin: <0.1 EU per 1 μg of the peptide by the LAL method
• Application: Sotatercept has been used in trials studying the supportive care and treatment of Anemia, Leukemia, Solid Tumors, Bladder Cancer, and multiple myeloma, among others.
• Publication: Antibody-based strategies for the detection of Luspatercept (ACE-536) in human serum (Reichel, C., Gmeiner, G., & Thevis, M.) (Drug Testing and Analysis) (2017).
  Detection of Sotatercept (ACE-011) in human serum by SAR-PAGE and western single blotting (Reichel, C., Farmer, L., Gmeiner, G.,et al.) (Drug Testing and Analysis) (2017).
  Testing for the erythropoiesis-stimulating agent Sotatercept/ACE-011 (ActRIIA-Fc) in serum by means of Western blotting and LC-HRMS (Walpurgis, K., Thomas, A., Vogel, M.,et al.) (Drug Testing and Analysis) (2016).
  

Pharmaceutical Information

• Pharmaceutical Application: Sotatercept
• Targets: Activin receptor type-2A