0
Inquiry Basket
Quote

Teriparatide, Recombinant human parathyroid hormone

Cat# : THP-0151

Product Datasheets COA :
Catalog# Product Name Availability Size Price Qty
THP-0151 Teriparatide, Recombinant human parathyroid hormone March 01, 2024 1 vial $3,998.00
Add to Car Online Order Request a Bulk Order
Cat#:  THP-0151
Product Name:  Teriparatide, Recombinant human parathyroid hormone
Description:  The product is a recombinant human parathyroid hormone, PTH (1-34).
Sequences:  SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNF
Species:  Human
Molecular Weight:  4117.715 Da
Purity:  >99% by SDS-Page and HPLC analysis
Cas No:  52232-67-4
Formula:  C181H291N55O51S2
Endotoxin Level:  <0.001 EU per 1 μg of the peptide by the LAL method
Biological Activity:  250 ug/1mL
For research use only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
CONTACT US

For more information on how our products could help advance your project, please contact us.

Contact Us

ENTER YOUR EMAIL HERE TO SUBSCRIBE.

Copyright © 2024 Creative BioMart. All Rights Reserved.