0
Inquiry Basket
Quote

Oprelvekin, IL11

Cat# : THP-0086

Product Datasheets COA :
Catalog# Product Name Availability Size Price Qty
THP-0086 Oprelvekin, IL11 April 14, 2024 1 vial $3,998.00
Add to Cart Online Order Request a Bulk Order
Cat#:  THP-0086
Product Name:  Oprelvekin, IL11
Description:  The active ingredient is recombinant Interleukin eleven, expressed in E. coli. The protein has a molecular mass of approximately 19,000 daltons, and is non-glycosylated. The polypeptide is 177 amino acids in length (the natural IL-11 has 178).
Sequences:  GPPPGPPRVSPDPRAELDSTVLLTRSLLADTRQLAAQLRDKFPADGDHNLDSLPTLAMSAGALGALQLPGVLTRLRADLLSYLRHVQWLRRAGGSSLKTLEPELGTLQARLDRLLRRLQLLMSRLALPQPPPDPPAPPLAPPSSAWGGIRAAHAILGGLHLTLDWAVRGLLLLKTRL
Species:  Human
Molecular Weight:  19047.2 Da
Source:  E. coli
Purity:  >99% by SDS-Page and HPLC analysis
Cas No:  145941-26-0
Formula:  C854H1411N253O235S2
Endotoxin Level:  <0.001 EU per 1 μg by the LAL method
Biological Activity:  5 mg/1mL
For research use only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.

Online Inquiry

  • Size: 100ug 500ug 1mg 5mg 10mg 100mg 500mg 1g
  • Conjugation: None R-PE APC Biotin FITC Alexa Flour Others
CONTACT US

For more information on how our products could help advance your project, please contact us.

Contact Us

ENTER YOUR EMAIL HERE TO SUBSCRIBE.

Copyright © 2024 Creative BioMart. All Rights Reserved.