0
Inquiry Basket
Quote

Teduglutide; GLP-2

Cat# : THP-0025

Product Datasheets COA :
Catalog# Product Name Availability Size Price Qty
THP-0025 Teduglutide; GLP-2 November 21, 2024 1 vial $3,998.00
Add to Cart Online Order Request a Bulk Order
Cat#:  THP-0025
Product Name:  Teduglutide; GLP-2
Cas No:  197922-42-2
Description:  The product is a glucagon-like peptide-2 (GLP-2) analogue. It is made up of 33 amino acids and is manufactured using a strain of Escherichia coli modified by recombinant DNA technology. The product differs from GLP-2 by one amino acid (alanine is substituted by glycine). The significance of this substitution is that the product is longer acting than endogenous GLP-2 as it is more resistant to proteolysis from dipeptidyl peptidase-4.
Sequences:  HGDGSFSDEMNTILDNLAARDFINWLIQTKITD
Species:  Human
Molecular Weight:  3752.0 Da
Source:  Escherichia coli
Formula:  C164H252N44O55S
Endotoxin:  <0.001 EU per 1 μg by the LAL method
Application:  Treatment of short bowel syndrome (SBS), malabsorption associated with the removal of the intestine, in adults patients who are dependent on parenteral support.
Concentration:  5mg/0.5ml
For research use only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.

Online Inquiry

  • Size: 100ug 500ug 1mg 5mg 10mg 100mg 500mg 1g
  • Conjugation: None R-PE APC Biotin FITC Alexa Flour Others
CONTACT US

For more information on how our products could help advance your project, please contact us.

Contact Us

ENTER YOUR EMAIL HERE TO SUBSCRIBE.

Copyright © 2024 Creative BioMart. All Rights Reserved.