Teduglutide; GLP-2

Specification

• Cat#: THP-0025
• Product Name: Teduglutide; GLP-2
• Description: The product is a glucagon-like peptide-2 (GLP-2) analogue. It is made up of 33 amino acids and is manufactured using a strain of Escherichia coli modified by recombinant DNA technology. The product differs from GLP-2 by one amino acid (alanine is substituted by glycine). The significance of this substitution is that the product is longer acting than endogenous GLP-2 as it is more resistant to proteolysis from dipeptidyl peptidase-4.
• Sequences: HGDGSFSDEMNTILDNLAARDFINWLIQTKITD
• Species: Human
• Molecular Weight: 3752.0 Da
• Source: Escherichia coli
• Cas No: 197922-42-2
• Formula: C164H252N44O55S
• Endotoxin Level: <0.001 EU per 1 μg by the LAL method
• Biological Activity: 5mg/0.5ml

Pharmaceutical Information

• Pharmaceutical Application: Teduglutide
• Applications: Treatment of short bowel syndrome (SBS), malabsorption associated with the removal of the intestine, in adults patients who are dependent on parenteral support.
• Examples of Clinical Use: Short bowel syndrome (SBS) and malabsorption
• Pharmacodynamics: An enhancement of gastrointestinal fluid absorption (750-1000 mL/day) was observed following daily administrations of the product. An increase in villus height and crypt depth of the intestinal mucosa was also noted. A decrease in fecal weight has also been observed. The product does not prolong the QTc interval.
• Mechanism of action: Teduglutide is an analog of naturally occurring human glucagon-like peptide-2 (GLP-2), a peptide secreted by L-cells of the distal intestine in response to meals. GLP-2 increases intestinal and portal blood flow and inhibit gastric acid secretion. Teduglutide binds to the glucagon-like peptide-2 receptors located in enteroendocrine cells, subepithelial myofibroblasts and enteric neurons of the submucosal and myenteric plexus. This causes the release of insulin-like growth factor (IGF)-1, nitric oxide and keratinocyte growth factor (KGF). These growth factors may contribute to the increase in crypt cell growth and surface area of the gastric mucosa. Ultimately, absorption through the intestine is enhanced.
• Affected organisms: Humans and other mammals
• Targets: Target 1. Glucagon-like peptide 2 receptor