0
Inquiry Basket
Quote

Palifermin, Recombinant human KGF

Cat# : THP-0113

Product Datasheets COA :
Catalog# Product Name Availability Size Price Qty
THP-0113 Palifermin, Recombinant human KGF April 15, 2024 100ug $698.00
1mg $3,998.00
Add to Cart Online Order Request a Bulk Order
Cat#:  THP-0113
Product Name:  Palifermin, Recombinant human KGF
Description:  Palifermin is a recombinant human keratinocyte growth factor (KGF) protein, which encodes 140 a.a. and expressed in E. coli.
Sequences:  MSYDYMEGGDIRVRRLFCRTQWYLRIDKRGKVKGTQEMKNNYNIMEIRTVAVGIVAIKGVESEFYLAMNKEGKLYAKKECNEDCNFKELILENHYNTYASAKWTHNGGEMFVALNQKGIPVRGKKTKKEQKTAHFLPMAIT
Species:  Human
Molecular Weight:  16192.7 Da
Source:  E. coli
Purity:  >99% by SDS-Page and HPLC analysis
Cas No:  162394-19-6
Formula:  C721H1142N202O204S9
Endotoxin Level:  <0.001 EU per 1 μg of the protein by the LAL method
Biological Activity:  6.25 mg/1mL
For research use only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.

Online Inquiry

  • Size: 100ug 500ug 1mg 5mg 10mg 100mg 500mg 1g
  • Conjugation: None R-PE APC Biotin FITC Alexa Flour Others
CONTACT US

For more information on how our products could help advance your project, please contact us.

Contact Us

ENTER YOUR EMAIL HERE TO SUBSCRIBE.

Copyright © 2024 Creative BioMart. All Rights Reserved.