Palifermin, Recombinant human KGF

Specification

• Cat#: THP-0113
• Product Name: Palifermin, Recombinant human KGF
• Description: Palifermin is a recombinant human keratinocyte growth factor (KGF) protein, which encodes 140 a.a. and expressed in E. coli.
• Sequences: MSYDYMEGGDIRVRRLFCRTQWYLRIDKRGKVKGTQEMKNNYNIMEIRTVAVGIVAIKGVESEFYLAMNKEGKLYAKKECNEDCNFKELILENHYNTYASAKWTHNGGEMFVALNQKGIPVRGKKTKKEQKTAHFLPMAIT
• Species: Human
• Molecular Weight: 16192.7 Da
• Source: E. coli
• Purity: >99% by SDS-Page and HPLC analysis
• Cas No: 162394-19-6
• Formula: C721H1142N202O204S9
• Endotoxin Level: <0.001 EU per 1 μg of the protein by the LAL method
• Biological Activity: 6.25 mg/1mL

Pharmaceutical Information

• Pharmaceutical Application: Palifermin
• Applications: For treatment of oral mucositis associated with chemotherapy and radiation therapy.
• Examples of Clinical Use: Oral mucositis
• Pharmacodynamics: Used in the prevention or treatment of oral mucoscitis (mouth ulcers arising from chemotherapy), the product binds to the human keratinocyte growth factor (KGF) receptor on buccal cell surfaces. The product acts as both a cell growth and survival factor by stimulating epithelial cell proliferation, differentiation, and migration around the tongue and mouth. The KGF receptor is found on many tissues particularly around the tongue, esophagus, salivary gland and other gastro-intestinal tract organs.
• Mechanism of action: Kepivance binds to the human keratinocyte growth factor (KGF) receptor found on buccal cell surfaces. The binding activates a Ras-MapK (Map kinase) signaling pathway which leads to the transcriptional activation of many proteins important for cell growth and survival.
• Affected organisms: Humans and other mammals
• Targets: Target 1. Fibroblast growth factor receptor 2; Target 2. Neuropilin-1; Target 3. Fibroblast growth factor receptor 1; Target 4. Fibroblast growth factor receptor 4; Target 5. Fibroblast growth factor receptor 3; Target 6. Basement membrane-specific heparan sulfate proteoglycan core protein