0
Inquiry Basket
Quote

Interferon gamma-1b(Recombinant)

Cat# : THP-0150

Product Datasheets COA :
Catalog# Product Name Availability Size Price Qty
THP-0150 Interferon gamma-1b(Recombinant) March 01, 2024 10ug $398.00
Add to Car Online Order Request a Bulk Order
THP-0150 Interferon gamma-1b(Recombinant) March 01, 2024 1mg $3,998.00
Add to Car Online Order Request a Bulk Order
Cat#:  THP-0150
Product Name:  Interferon gamma-1b(Recombinant)
Description:  This product encodes Human Interferon gamma-1b (140 residues), produced from E. coli via conventional column chromatography. Production of this therapeutic protein is achieved by fermentation of a genetically engineered E.coli bacterium containing the DNA which encodes for the human protein. The sequence displayed is a cDNA sequence which codes for human interferon gamma, as described by Gray et. al. and not specifically interferon gamma 1b.
Sequences:  CYCQDPYVKEAENLKKYFNAGHSDVADNGTLFLGILKNWKEESDRKIMQSQIVSFYFKLFKNFKDDQSIQKSVETIKEDMNVKFFNSNKKKRDDFEKLTNYSVTDLNVQRKAIHELIQVMAELSPAAKTGKRKRSQMLFRGRRASQ
Species:  Human
Molecular Weight:  17145.6 Da
Source:  E. coli
Purity:  >99% by SDS-Page and HPLC analysis
Cas No:  98059-61-1
Formula:  C761H1206N214O225S6
Endotoxin Level:  <0.001 EU per 1 μg of the peptide by the LAL method
Biological Activity:  100 ug/0.5mL
For research use only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
CONTACT US

For more information on how our products could help advance your project, please contact us.

Contact Us

ENTER YOUR EMAIL HERE TO SUBSCRIBE.

Copyright © 2024 Creative BioMart. All Rights Reserved.