0
Inquiry Basket
Quote

Interferon gamma-1b(Recombinant)

Cat# : THP-0150

Product Datasheets COA :
Catalog# Product Name Availability Size Price Qty
THP-0150 Interferon gamma-1b(Recombinant) November 21, 2024 10ug $398.00
1mg $3,998.00
Add to Cart Online Order Request a Bulk Order
Cat#:  THP-0150
Product Name:  Interferon gamma-1b(Recombinant)
Cas No:  98059-61-1
Description:  This product encodes Human Interferon gamma-1b (140 residues), produced from E. coli via conventional column chromatography. Production of this therapeutic protein is achieved by fermentation of a genetically engineered E.coli bacterium containing the DNA which encodes for the human protein. The sequence displayed is a cDNA sequence which codes for human interferon gamma, as described by Gray et. al. and not specifically interferon gamma 1b.
Sequences:  CYCQDPYVKEAENLKKYFNAGHSDVADNGTLFLGILKNWKEESDRKIMQSQIVSFYFKLFKNFKDDQSIQKSVETIKEDMNVKFFNSNKKKRDDFEKLTNYSVTDLNVQRKAIHELIQVMAELSPAAKTGKRKRSQMLFRGRRASQ
Species:  Human
Molecular Weight:  17145.6 Da
Source:  E. coli
Purity:  >99% by SDS-Page and HPLC analysis
Formula:  C761H1206N214O225S6
Endotoxin:  <0.001 EU per 1 μg of the peptide by the LAL method
Application:  Interferon gamma-1b is used for the treatment of Chronic granulomatous disease and Osteopetrosis.
Concentration:  100 ug/0.5mL
For research use only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.

Online Inquiry

  • Size: 100ug 500ug 1mg 5mg 10mg 100mg 500mg 1g
  • Conjugation: None R-PE APC Biotin FITC Alexa Flour Others
CONTACT US

For more information on how our products could help advance your project, please contact us.

Contact Us

ENTER YOUR EMAIL HERE TO SUBSCRIBE.

Copyright © 2024 Creative BioMart. All Rights Reserved.