0
Inquiry Basket
Quote

Insulin Aspart

Cat# : THP-0124

Product Datasheets COA :
Catalog# Product Name Availability Size Price Qty
THP-0124 Insulin Aspart March 01, 2024 1 vial $3,998.00
Add to Car Online Order Request a Bulk Order
Cat#:  THP-0124
Product Name:  Insulin Aspart
Description:  The product is a recombinant, biosynthetic, fast-acting insulin analogue. It has a single amino acid substitution at position B28 where proline is replaced with aspartic acid. This substitution decreases its propensity to form hexamers. The product is produced in a genetically modified strain of Saccharomyces cerevisiae and harvested from a bioreactor.
Sequences:  >A chain GIVEQCCTSICSLYQLENYCN >B chain FVNQHLCGSHLVEALYLVCGERGFFYTDKT
Molecular Weight:  5825.8 Da
Source:  Saccharomyces cerevisiae
Purity:  >99% by SDS-Page and HPLC analysis
Cas No:  116094-23-6
Formula:  C256H381N65O79S6
Endotoxin Level:  <0.1 EU per 1 μg of the protein by the LAL method
Biological Activity:  100U/ml
For research use only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
CONTACT US

For more information on how our products could help advance your project, please contact us.

Contact Us

ENTER YOUR EMAIL HERE TO SUBSCRIBE.

Copyright © 2024 Creative BioMart. All Rights Reserved.