Insulin Aspart

Specification

• Cat#: THP-0124
• Product Name: Insulin Aspart
• Cas No: 116094-23-6
• Description: The product is a recombinant, biosynthetic, fast-acting insulin analogue. It has a single amino acid substitution at position B28 where proline is replaced with aspartic acid. This substitution decreases its propensity to form hexamers. The product is produced in a genetically modified strain of Saccharomyces cerevisiae and harvested from a bioreactor.
• Sequences: >A chain GIVEQCCTSICSLYQLENYCN >B chain FVNQHLCGSHLVEALYLVCGERGFFYTDKT
• Molecular Weight: 5825.8 Da
• Source: Saccharomyces cerevisiae
• Purity: >99% by SDS-Page and HPLC analysis
• Formula: C256H381N65O79S6
• Endotoxin: <0.1 EU per 1 μg of the protein by the LAL method
• Biological Activity: 100U/ml
• Application: For the treatment of Type 1 or 2 diabetes mellitus. Should normally be used in conjunction with an intermediate or long-acting insulin.

Pharmaceutical Information

• Pharmaceutical Application: Insulin Aspart
• Targets: Target 1. Insulin receptor; Enzyme 1. Cytochrome P450 1A2