Exenatide, Glucagon-Like peptide-1 (GLP-1)

Specification

• Cat#: THP-0119
• Product Name: Exenatide, Glucagon-Like peptide-1 (GLP-1)
• Cas No: 141758-74-9
• Description: This product is a glucagon-like peptide-1 (GLP-1) analog that functions to activate the GLP-1 receptor and increases insulin secretion, decrease glucagon secretion, and slow gastric emptying to improve glycemic control.
• Sequences: HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS
• Species: Gila monster
• Molecular Weight: 4186.6 Da
• Purity: >99% by SDS-Page and HPLC analysis
• Formula: C184H282N50O60S
• Endotoxin: <0.001 EU per 1 μg of the protein by the LAL method
• Application: Indicated as adjunctive therapy to improve glycemic control in patients with Type 2 diabetes mellitus who are taking metformin, a sulfonylurea, or a combination of both, but have not achieved adequate glycemic control.
• Concentration: 250ug/ml

Pharmaceutical Information

• Pharmaceutical Application: Exenatide
• Targets: Target 1. Glucagon-like peptide 1 receptor; Enzyme 1. Serum albumin