Cat# : THP-0119
| Catalog# | Product Name | Availability | Size | Price | Qty |
|---|---|---|---|---|---|
| THP-0119 | Exenatide, Glucagon-Like peptide-1 (GLP-1) | January 03, 2026 | 1mg | $398.00 |
|
| 20mg | $3,998.00 |
|
| Add to Cart Online Order Request a Bulk Order |
| Cat#: | THP-0119 |
| Product Name: | Exenatide, Glucagon-Like peptide-1 (GLP-1) |
| Cas No: | 141758-74-9 |
| Description: | This product is a glucagon-like peptide-1 (GLP-1) analog that functions to activate the GLP-1 receptor and increases insulin secretion, decrease glucagon secretion, and slow gastric emptying to improve glycemic control. |
| Sequences: | HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS |
| Species: | Gila monster |
| Molecular Weight: | 4186.6 Da |
| Purity: | >99% by SDS-Page and HPLC analysis |
| Formula: | C184H282N50O60S |
| Endotoxin: | <0.001 EU per 1 μg of the protein by the LAL method |
| Application: | Indicated as adjunctive therapy to improve glycemic control in patients with Type 2 diabetes mellitus who are taking metformin, a sulfonylurea, or a combination of both, but have not achieved adequate glycemic control. |
| Concentration: | 250ug/ml |
For more information on how our products could help advance your project, please contact us.
ENTER YOUR EMAIL HERE TO SUBSCRIBE.
Copyright © 2026 Creative BioMart. All Rights Reserved.