0
Inquiry Basket
Quote

Exenatide, Glucagon-Like peptide-1 (GLP-1)

Cat# : THP-0119

Product Datasheets COA :
Catalog# Product Name Availability Size Price Qty
THP-0119 Exenatide, Glucagon-Like peptide-1 (GLP-1) May 18, 2024 1mg $398.00
20mg $3,998.00
Add to Cart Online Order Request a Bulk Order
Cat#:  THP-0119
Product Name:  Exenatide, Glucagon-Like peptide-1 (GLP-1)
Description:  This product is a glucagon-like peptide-1 (GLP-1) analog that functions to activate the GLP-1 receptor and increases insulin secretion, decrease glucagon secretion, and slow gastric emptying to improve glycemic control.
Sequences:  HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS
Species:  Gila monster
Molecular Weight:  4186.6 Da
Purity:  >99% by SDS-Page and HPLC analysis
Cas No:  141758-74-9
Formula:  C184H282N50O60S
Endotoxin Level:  <0.001 EU per 1 μg of the protein by the LAL method
Biological Activity:  250ug/ml
For research use only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.

Online Inquiry

  • Size: 100ug 500ug 1mg 5mg 10mg 100mg 500mg 1g
  • Conjugation: None R-PE APC Biotin FITC Alexa Flour Others
CONTACT US

For more information on how our products could help advance your project, please contact us.

Contact Us

ENTER YOUR EMAIL HERE TO SUBSCRIBE.

Copyright © 2024 Creative BioMart. All Rights Reserved.