0
Inquiry Basket
Quote

Ecallantide

Cat# : THP-0015

Product Datasheets COA :
Catalog# Product Name Availability Size Price Qty
THP-0015 Ecallantide March 01, 2024 1 vial $3,998.00
Add to Car Online Order Request a Bulk Order
Cat#:  THP-0015
Product Name:  Ecallantide
Description:  The product is a recombinant 60-amino-acid protein produced in Pichia pastoris yeast cells that contains three intramolecular disulfide bonds. It shares sequence similarities with the naturally occurring human protein tissue-factor pathway inhibitor (TFPI), which is also known lipoprotein-associated coagulation inhibitor (LACI). The amino acid sequence of two compounds differ by seven amino acids.
Sequences:  EAMHSFCAFKADDGPCRAAHPRWFFNIFTRQCEEFIYGGCEGNQNRFESLEECKKMCTRD
Species:  Human
Molecular Weight:  7054.0 Da (glycosylated)
Purity:  >99% by SDS-Page and HPLC analysis
Cas No:  460738-38-9
Formula:  C305H442N88O91S8
Endotoxin Level:  <0.001 EU per 1 μg by the LAL method
Biological Activity:  10mg/ml
For research use only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
CONTACT US

For more information on how our products could help advance your project, please contact us.

Contact Us

ENTER YOUR EMAIL HERE TO SUBSCRIBE.

Copyright © 2024 Creative BioMart. All Rights Reserved.