Cat# : THP-0015
| Catalog# | Product Name | Availability | Size | Price | Qty |
|---|---|---|---|---|---|
| THP-0015 | Ecallantide | November 21, 2024 | 1 vial | $3,998.00 |
|
| Add to Cart Online Order Request a Bulk Order | |||||
| Cat#: | THP-0015 |
| Product Name: | Ecallantide |
| Cas No: | 460738-38-9 |
| Description: | The product is a recombinant 60-amino-acid protein produced in Pichia pastoris yeast cells that contains three intramolecular disulfide bonds. It shares sequence similarities with the naturally occurring human protein tissue-factor pathway inhibitor (TFPI), which is also known lipoprotein-associated coagulation inhibitor (LACI). The amino acid sequence of two compounds differ by seven amino acids. |
| Sequences: | EAMHSFCAFKADDGPCRAAHPRWFFNIFTRQCEEFIYGGCEGNQNRFESLEECKKMCTRD |
| Species: | Human |
| Molecular Weight: | 7054.0 Da (glycosylated) |
| Purity: | >99% by SDS-Page and HPLC analysis |
| Formula: | C305H442N88O91S8 |
| Endotoxin: | <0.001 EU per 1 μg by the LAL method |
| Application: | Indicated for the symptomatic treatment of acute attacks of hereditary angioedema (HAE) in patients 12 years of age and older. |
| Concentration: | 10mg/ml |
For more information on how our products could help advance your project, please contact us.
ENTER YOUR EMAIL HERE TO SUBSCRIBE.
Copyright © 2024 Creative BioMart. All Rights Reserved.
