Cat# : THP-0184
Catalog# | Product Name | Availability | Size | Price | Qty |
---|---|---|---|---|---|
THP-0184 | Becaplermin, Recombinant Human PDGFB | September 16, 2025 | 1 vial | $3,998.00 |
|
Add to Cart Online Order Request a Bulk Order |
Cat#: | THP-0184 |
Product Name: | Becaplermin, Recombinant Human PDGFB |
Cas No: | 165101-51-9 |
Description: | The product is produced by recombinant DNA technology by insertion of the gene for the B chain of platelet derived growth factor (PDGF) into the yeast, Saccharomyces cerevisiae. The product has a molecular weight of approximately 25 KD and is a homodimer composed of two identical polypeptide chains that are bound together by disulfide bonds. |
Sequences: | SLGSLTIAEPAMIAECKTRTEVFEISRRLIDRTNANFLVWPPCVEVQRCSGCCNNRNVQCRPTQVQLRPVQVRKIEIVRKKPIFKKATVTLEDHLACKCETVAAARPVT |
Species: | Human |
Molecular Weight: | 12294.4 Da |
Source: | Yeast |
Purity: | >99% by SDS-Page and HPLC analysis |
Formula: | C532H892N162O153S9 |
Endotoxin: | <0.001 EU per 1 μg of the peptide by the LAL method |
Storage: | Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 2-8 °C for 1 week. Aliquots of reconstituted samples are stable at < -20°C for 3 months. |
Application: | For topical treatment of skin ulcers (from diabetes). |
Concentration: | 100 ug/1g |
For more information on how our products could help advance your project, please contact us.
ENTER YOUR EMAIL HERE TO SUBSCRIBE.
Copyright © 2025 Creative BioMart. All Rights Reserved.