0
Inquiry Basket
Check Out

Becaplermin, Recombinant Human PDGFB

Cat# : THP-0184

Product Datasheets COA :
Catalog# Product Name Availability Size Price Qty
THP-0184 Becaplermin, Recombinant Human PDGFB September 27, 2023 1 vial $3,998.00
Add to Cart Online Order Request a Bulk Order
Cat#:  THP-0184
Product Name:  Becaplermin, Recombinant Human PDGFB
Description:  The product is produced by recombinant DNA technology by insertion of the gene for the B chain of platelet derived growth factor (PDGF) into the yeast, Saccharomyces cerevisiae. The product has a molecular weight of approximately 25 KD and is a homodimer composed of two identical polypeptide chains that are bound together by disulfide bonds.
Sequences:  SLGSLTIAEPAMIAECKTRTEVFEISRRLIDRTNANFLVWPPCVEVQRCSGCCNNRNVQCRPTQVQLRPVQVRKIEIVRKKPIFKKATVTLEDHLACKCETVAAARPVT
Species:  Human
Molecular Weight:  12294.4 Da
Source:  Yeast
Purity:  >99% by SDS-Page and HPLC analysis
Cas No:  165101-51-9
Formula:  C532H892N162O153S9
Endotoxin Level:  <0.001 EU per 1 μg of the peptide by the LAL method
Biological Activity:  100 ug/1g
Storage:  Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 2-8 °C for 1 week. Aliquots of reconstituted samples are stable at < -20°C for 3 months.
For research use only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.

Online Inquiry

  • Size: 100ug 500ug 1mg 5mg 10mg 100mg 500mg 1g
  • Conjugation: None R-PE APC Biotin FITC Alexa Flour Others
CONTACT US

For more information on how our products could help advance your project, please contact us.

Contact Us

ENTER YOUR EMAIL HERE TO SUBSCRIBE.

Copyright © 2023 Creative BioMart. All Rights Reserved.