0
Inquiry Basket
Quote

Tagraxofusp

Cat# : THP-0196

Product Datasheets COA :
Catalog# Product Name Availability Size Price Qty
THP-0196 Tagraxofusp March 01, 2024 1 vial $3,998.00
Add to Car Online Order Request a Bulk Order
Cat#:  THP-0196
Product Name:  Tagraxofusp
Description:  The product is an IL-3 conjugated truncated diphtheria toxin. It is composed by the catalytic and translocation domains of diphtheria toxin fused via Met-His linker to a full-length human IL-3.
Sequences:  MGADDVVDSSKSFVMENFSSYHGTKPGYVDSIQKGIQKPKSGTQGNYDDDWKGFYSTDNKYDAAGYSVDNENPLSGKAGGVVKVTYPGLTKVLALKVDNAETIKKELGLSLTEPLMEQVGTEEFIKRFGDGASRVVLSLPFAEGSSSVEYINNWEQAKALSVELEINFETRGKRGQDAMYEYMAQACAGNRVRRSVGSSLSCINLDWDVIRDKTKTKIESLKEHGPIKNKMSESPNKTVSEEKAKQYLEEFHQTALEHPELSELKTVTGTNPVFAGANYAAWAVNVAQVIDSETADNLEKTTAALSILPGIGSVMGIADGAVHHNTEEIVAQSIALSSLMVAQAIPLVGELVDIGFAAYNFVESIINLFQVVHNSYNRPAYSPGHKTRPHMAPMTQTTSLKTSWVNCSNMIDEIITHLKQPPLPLLDFNNLNGEDQDILMENNLRRPNLEAFNRAVKSLQNASAIESILKNLLPCLPLATAAPTRHPIHIKDGDWNEFRRKLTFYLKTLENAQAQQTTLSLAIF
Species:  Human
Molecular Weight:  Not Available
Purity:  >99% by SDS-Page and HPLC analysis
Cas No:  2055491-00-2
Formula:  C2553 H4026 N692 O798 S16
Endotoxin Level:  <0.001 EU per 1 μg of the peptide by the LAL method
Biological Activity:  1 mg/ml
For research use only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
CONTACT US

For more information on how our products could help advance your project, please contact us.

Contact Us

ENTER YOUR EMAIL HERE TO SUBSCRIBE.

Copyright © 2024 Creative BioMart. All Rights Reserved.