0
Inquiry Basket
Quote

rhMBL

Cat# : THP-0209

Product Datasheets COA :
Catalog# Product Name Availability Size Price Qty
THP-0209 rhMBL March 01, 2024 1 vial $3,998.00
Add to Car Online Order Request a Bulk Order
Cat#:  THP-0209
Product Name:  rhMBL
Description:  rhMBL is a protein therapeutic being developed for the prevention and treatment of severe infections in individuals with low levels of Mannose-Binding Lectin (MBL). Natural MBL is a 400-700kDa oligomer made of 3 identical 32kDa peptide chains. MBL forms different oligomers but must form at least a tetramer to be active. This product encodes human MBL2 sequence.
Sequences:  MSLFPSLPLLLLSMVAASYSETVTCEDAQKTCPAVIACSSPGINGFPGKDGRDGTKGEKG
Species:  Human
Molecular Weight:  Not Available
Purity:  >99% by SDS-Page and HPLC analysis
Cas No:  Not Available
Formula:  Not Available
Endotoxin Level:  <0.001 EU per 1 μg of the peptide by the LAL method
For research use only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
CONTACT US

For more information on how our products could help advance your project, please contact us.

Contact Us

ENTER YOUR EMAIL HERE TO SUBSCRIBE.

Copyright © 2024 Creative BioMart. All Rights Reserved.