Porcine Pepsin

Specification

• Cat#: THP-0042
• Product Name: Porcine Pepsin
• Description: The product is a potent enzyme in gastric juice that digests proteins such as those in meat, eggs, seeds, and dairy products. Studies on gastric digestion from 1820-1840 led to the discovery of the product as the substance which, in the presence of stomach acid, causes nutrients including meat or coagulated egg whites to dissolve. Soon afterward, it was shown that these protein nutrients were cleaved by the product to products called peptones.
• Sequences: MKWLLLLSLVVLSECLVKVPLVRKKSLRQNLIKNGKLKDFLKTHKHNPASKYFPEAAALIGDEPLENYLDTEYFGTIGIGTPAQDFTVIFDTGSSNLWVPSVYCSSLACSDHNQFNPDDSSTFEATSQELSITYGTGSMTGILGYDTVQVGGISDTNQIFGLSETEPGSFLYYAPFDGILGLAYPSISASGATPVFDNLWDQGLVSQDLFSVYLSSNDDSGSVVLLGGIDSSYYTGSLNWVPVSVEGYWQITLDSITMDGETIACSGGCQAIVDTGTSLLTGPTSAIANIQSDIGASENSDGEMVISCSSIDSLPDIVFTINGVQYPLSPSAYILQDDDSCTSGFEGMDVPTSSGELWILGDVFIRQYYTVFDRANNKVGLAPVA
• Species: Porcine
• Molecular Weight: Not Available
• Cas No: 9001-75-6
• Formula: Not Available
• Endotoxin Level: <0.001 EU per 1 μg of the peptide by the LAL method
• Biological Activity: 100 mg / 30 mL

Pharmaceutical Information

• Pharmaceutical Application: Pepsin
• Applications: Used as a pancreatic enzyme replacement in pancreatic insufficiency. The product powder is prepared from the gastric mucosa of pigs, cattle or sheep. In the laboratory, it is primarily used for the unspecific hydrolysis of proteins and peptides in acidic media. In addition, it provides limited hydrolysis of native immunoglobulins, yielding biologically active fragments.In certain supplements, the product may be combined with betaine and HCl (hydrochloric acid) to aid in digestion in various gastrointestinal conditions.
• Examples of Clinical Use: Pancreatic insufficiency
• Pharmacodynamics: The product digests protein. It classified by the FDA that is characterizing enzyme activity is that of a peptide hydrolase.
• Mechanism of action: Glands present in the mucous membrane lining of the stomach produce and store an inactive protein named pepsinogen. Impulses from the vagus nerve and the hormonal secretions of the hormones gastrin and secretin promote the release of pepsinogen into the stomach, where it is mixed with hydrochloric acid and quickly converted to the active enzyme pepsin. The digestive potency of pepsin is highest at the acidic pH of normal gastric juice. In the intestine, the gastric acids are then neutralized, and pepsin is no longer effective.
• Affected organisms: Humans and other mammals

Related Reading

Porcine Pepsin, an enzyme secreted by the gastric mucosa of pigs, exerts its function in the presence of gastric acid and plays a pivotal role in the digestion and degradation of proteins. This article provides an overview of the background, function, associated signaling pathways, diseases, and the potential medical applications as well as the development of pharmaceuticals related to Porcine Pepsin.

Background Overview of Porcine Pepsin

Porcine Pepsin, derived from pig gastric mucosa, aids in protein digestion by breaking them down into smaller peptides and amino acids. Discovered in the 19th century, it has wide applications in medicine and the food industry. In medicine, it evaluates gastric function and assists in diagnosing and treating gastric diseases. It is also used as a raw material for digestive enzyme medications. In the food industry, Porcine Pepsin enhances the taste and texture of various products like meat, dairy, and bread. However, it is important to consider dietary restrictions and prioritize safety and purity due to its animal origin and specific applications.

Porcine Pepsin: Enhancing Protein Digestion and Managing Digestive Disorders

Porcine Pepsin, as a digestive enzyme, primarily functions in the digestion and degradation of proteins. In the presence of gastric acid, Porcine Pepsin can break down proteins into smaller peptide chains and amino acids. Proteins are essential nutrients in the human body, but in their original form, they are difficult to be effectively absorbed and utilized by the digestive tract. By breaking down proteins into smaller molecules, Porcine Pepsin helps improve the efficiency of digestion and absorption, thereby providing the necessary nutrients for the body. Additionally, Porcine Pepsin can aid in managing digestive disorders or gastrointestinal issues. When there is insufficient secretion of gastric acid or restricted gastrointestinal motility, the digestion and absorption of proteins may be compromised. Supplementing with exogenous Porcine Pepsin can help increase the supply of digestive enzymes, facilitating the normal digestion and absorption of proteins. To summarize, the primary function of Porcine Pepsin is to participate in the digestion and degradation of proteins, providing the body with necessary nutrients, and it can assist in managing digestive disorders or gastrointestinal issues.

Porcine Pepsin Regulation

The activity of Porcine Pepsin, as a digestive enzyme, is regulated by gastric acid. The presence of gastric acid stimulates the secretion of this digestive enzyme by the gastric wall cells and activates the function of Porcine Pepsin under the stimulation of gastric acid. Additionally, neural and hormonal regulation also play a significant role in the secretion of Porcine Pepsin. The nervous system regulates the production and release of gastric acid and Porcine Pepsin by releasing neurotransmitters such as acetylcholine and catecholamines. Simultaneously, gastric acid stimulation can also trigger the release of gastrin, further stimulating the secretion of Porcine Pepsin.

Digestive Disorders Associated with Human Secretin

Human Secretin plays a crucial role in the pancreas, gallbladder, and gastrointestinal tract. Abnormal function or deficiency of Human Secretin may lead to pancreatic insufficiency, gallbladder dysfunction, and gastrointestinal motility disorders. Symptoms such as pancreatic enzyme deficiency, gallbladder stones, and gastrointestinal functional disorders may be associated with Human Secretin. However, the exact relationship between Human Secretin and these diseases, as well as the underlying mechanisms of disease, require further investigation.

The Potential of Porcine Pepsin in the Medical Field

As a digestive enzyme, Porcine Pepsin plays a crucial role in the digestion and degradation of proteins and, therefore, holds significant importance in the treatment of digestive system disorders. One notable application is in the diagnosis of gastrointestinal-related diseases. Healthcare professionals can evaluate the digestive function of the gastrointestinal tract by measuring the levels of Porcine Pepsin in the patient's body. For instance, symptoms of excessive or reduced gastric acid production may be indicative of an imbalance in gastric acid secretion, and measuring the levels of Porcine Pepsin can provide information regarding gastric acid secretion. Additionally, Porcine Pepsin can be used in the treatment of certain gastrointestinal disorders. For example, individuals suffering from gastroesophageal reflux disease (GERD) may undergo treatment with Porcine Pepsin to help restore the balance of gastric acid and alleviate symptoms.

List of Medications Related to Porcine Pepsin

Pepsin: This medication contains Porcine Pepsin and is commonly used to treat symptoms of indigestion and insufficient gastric acid secretion. It aids in promoting the digestion and degradation of proteins, thereby improving gastrointestinal function.
Pepsinogen: This is a precursor to Pepsin, the stomach protease, which can be activated by the action of gastric acid. Pepsinogen in its medicinal form can be used to treat certain conditions characterized by low gastric acid secretion.
Digestive Enzyme Supplements: These medications typically contain a variety of digestive enzymes, including Porcine Pepsin, to aid in promoting digestion and absorption of food. They are commonly used to treat gastrointestinal digestive disorders, aid in post-gastrointestinal surgeries recovery, and manage certain gastrointestinal conditions.