Porcine Pepsin

Specification

• Cat#: THP-0042
• Product Name: Porcine Pepsin
• Cas No: 9001-75-6
• Description: The product is a potent enzyme in gastric juice that digests proteins such as those in meat, eggs, seeds, and dairy products. Studies on gastric digestion from 1820-1840 led to the discovery of the product as the substance which, in the presence of stomach acid, causes nutrients including meat or coagulated egg whites to dissolve. Soon afterward, it was shown that these protein nutrients were cleaved by the product to products called peptones.
• Sequences: MKWLLLLSLVVLSECLVKVPLVRKKSLRQNLIKNGKLKDFLKTHKHNPASKYFPEAAALIGDEPLENYLDTEYFGTIGIGTPAQDFTVIFDTGSSNLWVPSVYCSSLACSDHNQFNPDDSSTFEATSQELSITYGTGSMTGILGYDTVQVGGISDTNQIFGLSETEPGSFLYYAPFDGILGLAYPSISASGATPVFDNLWDQGLVSQDLFSVYLSSNDDSGSVVLLGGIDSSYYTGSLNWVPVSVEGYWQITLDSITMDGETIACSGGCQAIVDTGTSLLTGPTSAIANIQSDIGASENSDGEMVISCSSIDSLPDIVFTINGVQYPLSPSAYILQDDDSCTSGFEGMDVPTSSGELWILGDVFIRQYYTVFDRANNKVGLAPVA
• Species: Porcine
• Molecular Weight: Not Available
• Formula: Not Available
• Endotoxin: <0.001 EU per 1 μg of the peptide by the LAL method
• Application: Used as a pancreatic enzyme replacement in pancreatic insufficiency. The product powder is prepared from the gastric mucosa of pigs, cattle or sheep. In the laboratory, it is primarily used for the unspecific hydrolysis of proteins and peptides in acidic media. In addition, it provides limited hydrolysis of native immunoglobulins, yielding biologically active fragments.In certain supplements, the product may be combined with betaine and HCl (hydrochloric acid) to aid in digestion in various gastrointestinal conditions.
• Concentration: 100 mg / 30 mL

Pharmaceutical Information

• Pharmaceutical Application: Pepsin