Palivizumab

Specification

• Cat#: THA-0023
• Product Name: Palivizumab
• Description: Palivizumab is a monoclonal anti respiratory syncytial virus F protein antibody used to prevent serious sequelae caused by respiratory syncytial virus infection in pediatric patients.
• Sequences: VH region MEDI-493: QVTLRESGPALVKPTQTLTLTCTFSGFSLSTSGMSVGWIRQPPGKALEWLADIWWDDKKDYNPSLKSRLTISKDTSKNQVVLKVTNMDPADTATYYCARSMITNWYFDVWGAGTTVTVSS VH Region: QVTLRESGPALVKPTQTLTLTCTFSGFSLSTSGMSVGWIRQPPGKALEWLADIWWDDKKDYNPSLKSRLTISKDTSKNQVVLKVTNMDPADTATYYCARSMITNWYFDVWGAGTTVTVSS
• Molecular Weight: Not Available
• Introduction: Humanized monoclonal antibody (IgG1k) produced by recombinant DNA technology, directed to an epitope in the A antigenic site of the F protein of respiratory syncytial virus (RSV). Synagis is a composite of human (95%) and murine (5%) antibody sequences. The human heavy chain sequence was derived from the constant domains of human IgG1 and the variable framework regions of the VH genes Cor (1) and Cess (2). The human lightchain sequence was derived from the constant domain of Ck and the variable framework regions of the VL gene K104 withJk-4. Palivizumab is expressed from a stable murine (mouse) myeloma cell line (NS0). Palivizumab is composed of to heavy chains (50.6 kDa each) and two light chains (27.6 kDa each), contains 1-2% carbohydrate by weight and has a molecular weight of 147.7 kDa +/- 1 kDa (MALDI-TOF)
• Purity: >99% by SDS-Page and HPLC analysis
• Formula: Not Available
• Appearance: Liquid

Pharmaceutical Information

• Pharmacodynamics: Synagis exhibits neutralizing and fusion-inhibitory activity against Respiratory syncytial virus (RSV). These activities inhibit RSV replication or spread. Synagis is given to prevent the development of lower respiratory tract disease in pediatric patients.
• Targets: Fusion glycoprotein F0 ULow affinity immunoglobulin gamma Fc region receptor III-B UComplement C1r subcomponent UComplement C1q subcomponent subunit A UComplement C1q subcomponent subunit B UComplement C1q subcomponent subunit C ULow affinity immunoglobulin gamma Fc region receptor III-A UHigh affinity immunoglobulin gamma Fc receptor I ULow affinity immunoglobulin gamma Fc region receptor II-b