Interferon beta-1a

Specification Drug Information Related Products

Cat#:	THP-0181
Product Name:	Interferon beta-1a
Description:	Recombinant Human interferon beta (166 residues), glycosylated, MW=22.5kD, expressed in CHO Cells.
Sequences:	MSYNLLGFLQRSSNFQCQKLLWQLNGRLEYCLKDRMNFDIPEEIKQLQQFQKEDAALTIYEMLQNIFAIFRQDSSSTGWNETIVENLLANVYHQINHLKTVLEEKLEKEDFTRGKLMSSLHLKRYYGRILHYLKAKEYSHCAWTIVRVEILRNFYFINRLTGYLRN
Species:	Human
Molecular Weight:	20027.0 Da
Source:	CHO
Purity:	>99% by SDS-Page and HPLC analysis
Cas No:	145258-61-3
Formula:	C908H1408N246O252S7
Endotoxin Level:	<0.001 EU per 1 μg of the peptide by the LAL method
Biological Activity:	30 ug/1mL

Drug Name:	Interferon beta-1a
Applications:	For treatment of relapsing/remitting multiple sclerosis, also for condyloma acuminatum
Examples of Clinical Use:	Relapsing/remitting multiple sclerosis, also for condyloma acuminatum
Pharmacodynamics:	The product upregulates the expression of MHC I proteins, allowing for increased presentation of peptides derived from viral antigens. This enhances the activation of CD8+ T cells that are the precursors for cytotoxic T lymphocytes (CTLs) and makes the macrophage a better target for CTL-mediated killing. Type I interferons also induce the synthesis of several key antiviral mediators including 2'-5' oligoadenylate synthetase (2'-5' A synthetase), beta-2 microglobulin and neopterin.
Mechanism of action:	Interferon beta binds to type I interferon receptors (IFNAR1 and IFNAR2c) which, upon dimerization, activate two Jak (Janus kinase) tyrosine kinases (Jak1 and Tyk2). These transphosphorylate themselves and phosphorylate the receptors. The phosphorylated INFAR receptors then bind to Stat1 and Stat2 (signal transducers and activators of transcription) which dimerize and activate multiple (~100) immunomodulatory and antiviral proteins. Interferon beta binds more stably to type I interferon receptors than interferon alpha.
Affected organisms:	Not Available
Targets:	Target 1. Interferon alpha/beta receptor 1; Target 2. Interferon alpha/beta receptor 2