0
Inquiry Basket
Quote

Interferon beta-1a

Cat# : THP-0181

Product Datasheets COA :
Catalog# Product Name Availability Size Price Qty
THP-0181 Interferon beta-1a March 01, 2024 1 vial $3,998.00
Add to Car Online Order Request a Bulk Order
Cat#:  THP-0181
Product Name:  Interferon beta-1a
Description:  Recombinant Human interferon beta (166 residues), glycosylated, MW=22.5kD, expressed in CHO Cells.
Sequences:  MSYNLLGFLQRSSNFQCQKLLWQLNGRLEYCLKDRMNFDIPEEIKQLQQFQKEDAALTIYEMLQNIFAIFRQDSSSTGWNETIVENLLANVYHQINHLKTVLEEKLEKEDFTRGKLMSSLHLKRYYGRILHYLKAKEYSHCAWTIVRVEILRNFYFINRLTGYLRN
Species:  Human
Molecular Weight:  20027.0 Da
Source:  CHO
Purity:  >99% by SDS-Page and HPLC analysis
Cas No:  145258-61-3
Formula:  C908H1408N246O252S7
Endotoxin Level:  <0.001 EU per 1 μg of the peptide by the LAL method
Biological Activity:  30 ug/1mL
For research use only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
CONTACT US

For more information on how our products could help advance your project, please contact us.

Contact Us

ENTER YOUR EMAIL HERE TO SUBSCRIBE.

Copyright © 2024 Creative BioMart. All Rights Reserved.