Galsulfase, Human N-acetylgalactosamine 4-sulfatase

Specification

• Cat#: THP-0120
• Product Name: Galsulfase, Human N-acetylgalactosamine 4-sulfatase
• Cas No: 552858-79-4
• Description: The product is a recombinant variant form of the polymorphic human enzyme N-acetylgalactosamine 4-sulfatase, also a 56KDa glycoprotein. This enzyme is comprised of 495 amino acids and contains six asparagine-linked glycosylation sites, four of which carry a bis mannose-6-phosphate manose7 oligosaccharide for specific cellular recognition. Post-translational modification of Cys53 produces the catalytic amino acid residue Ca-formylglycine, which is required for enzyme activity and is conserved in all members of the sulfatase enzyme family.
• Sequences: SGAGASRPPHLVFLLADDLGWNDVGFHGSRIRTPHLDALAAGGVLLDNYYTQPLCTPSRSQLLTGRYQIRTGLQHQIIWPCQPSCVPLDEKLLPQLLKEAGYTTHMVGKWHLGMYRKECLPTRRGFDTYFGYLLGSEDYYSHERCTLIDALNVTRCALDFRDGEEVATGYKNMYSTNIFTKRAIALITNHPPEKPLFLYLALQSVHEPLQVPEEYLKPYDFIQDKNRHHYAGMVSLMDEAVGNVTAALKSSGLWNNTVFIFSTDNGGQTLAGGNNWPLRGRKWSLWEGGVRGVGFVASPLLKQKGVKNRELIHISDWLPTLVKLARGHTNGTKPLDGFDVWKTISEGSPSPRIELLHNIDPNFVDSSPCPRNSMAPAKDDSSLPEYSAFNTSVHAAIRHGNWKLLTGYPGCGYWFPPPSQYNVSEIPSSDPPTKTLWLFDIDRDPEERHDLSREYPHIVTKLLSRLQFYHKHSVPVYFPAQDPRCDPKATGVWGPWM
• Species: Human
• Molecular Weight: 56012.6 Da
• Purity: >99% by SDS-Page and HPLC analysis
• Formula: C2534H3851N691O719S16
• Endotoxin: <0.001 EU per 1 μg of the protein by the LAL method
• Application: For the treatment of adults and children with Mucopolysaccharidosis VI.
• Concentration: 1mg/ml

Pharmaceutical Information

• Pharmaceutical Application: Galsulfase
• Targets: Target 1. Dermatan sulfate; Target 2. Perilipin-3