Cat# : THP-0120
Catalog# | Product Name | Availability | Size | Price | Qty |
---|---|---|---|---|---|
THP-0120 | Galsulfase, Human N-acetylgalactosamine 4-sulfatase | March 13, 2025 | 1 vial | $3,998.00 |
|
Add to Cart Online Order Request a Bulk Order |
Cat#: | THP-0120 |
Product Name: | Galsulfase, Human N-acetylgalactosamine 4-sulfatase |
Cas No: | 552858-79-4 |
Description: | The product is a recombinant variant form of the polymorphic human enzyme N-acetylgalactosamine 4-sulfatase, also a 56KDa glycoprotein. This enzyme is comprised of 495 amino acids and contains six asparagine-linked glycosylation sites, four of which carry a bis mannose-6-phosphate manose7 oligosaccharide for specific cellular recognition. Post-translational modification of Cys53 produces the catalytic amino acid residue Ca-formylglycine, which is required for enzyme activity and is conserved in all members of the sulfatase enzyme family. |
Sequences: | SGAGASRPPHLVFLLADDLGWNDVGFHGSRIRTPHLDALAAGGVLLDNYYTQPLCTPSRSQLLTGRYQIRTGLQHQIIWPCQPSCVPLDEKLLPQLLKEAGYTTHMVGKWHLGMYRKECLPTRRGFDTYFGYLLGSEDYYSHERCTLIDALNVTRCALDFRDGEEVATGYKNMYSTNIFTKRAIALITNHPPEKPLFLYLALQSVHEPLQVPEEYLKPYDFIQDKNRHHYAGMVSLMDEAVGNVTAALKSSGLWNNTVFIFSTDNGGQTLAGGNNWPLRGRKWSLWEGGVRGVGFVASPLLKQKGVKNRELIHISDWLPTLVKLARGHTNGTKPLDGFDVWKTISEGSPSPRIELLHNIDPNFVDSSPCPRNSMAPAKDDSSLPEYSAFNTSVHAAIRHGNWKLLTGYPGCGYWFPPPSQYNVSEIPSSDPPTKTLWLFDIDRDPEERHDLSREYPHIVTKLLSRLQFYHKHSVPVYFPAQDPRCDPKATGVWGPWM |
Species: | Human |
Molecular Weight: | 56012.6 Da |
Purity: | >99% by SDS-Page and HPLC analysis |
Formula: | C2534H3851N691O719S16 |
Endotoxin: | <0.001 EU per 1 μg of the protein by the LAL method |
Application: | For the treatment of adults and children with Mucopolysaccharidosis VI. |
Concentration: | 1mg/ml |
For more information on how our products could help advance your project, please contact us.
ENTER YOUR EMAIL HERE TO SUBSCRIBE.
Copyright © 2025 Creative BioMart. All Rights Reserved.