Cat# : THP-0308
| Catalog# | Product Name | Availability | Size | Price | Qty |
|---|---|---|---|---|---|
| THP-0308 | Trebananib | December 22, 2024 | 1 vial | $2,998.00 |
|
| Add to Cart Online Order Request a Bulk Order | |||||
| Cat#: | THP-0308 |
| Product Name: | Trebananib |
| Cas No: | 894356-79-7 |
| Description: | An angiopoietin (Ang) 1 and 2 neutralizing peptibody, with potential antiangiogenic activity. Trebananib targets and binds to Ang1 and Ang2, thereby preventing the interaction of the angiopoietins with their target tie2 receptors. This may inhibit angiogenesis and may eventually lead to an inhibition of tumor cell proliferation. |
| Sequences: | MDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGKGGGGGAQQEECEWDPWTCEHMGSGSATGGSGSTASSGSGSATHQEECEWDPWTCEHMLE |
| Species: | Human |
| Molecular Weight: | 63.47 kDa |
| Formula: | C2794H4248N752O886S30 |
| Endotoxin: | <0.1 EU per 1 μg of the peptide by the LAL method |
| Application: | Trebananib is under investigation for the treatment of Ovarian Cancer, Peritoneal Cancer, and Fallopian Tube Cancer. Trebananib has been investigated for the treatment of Cancer, Oncology, Carcinoma, Metastases, and Colon Cancer, among others. |
For more information on how our products could help advance your project, please contact us.
ENTER YOUR EMAIL HERE TO SUBSCRIBE.
Copyright © 2024 Creative BioMart. All Rights Reserved.
