Trebananib

Specification

• Cat#: THP-0308
• Product Name: Trebananib
• Description: An angiopoietin (Ang) 1 and 2 neutralizing peptibody, with potential antiangiogenic activity. Trebananib targets and binds to Ang1 and Ang2, thereby preventing the interaction of the angiopoietins with their target tie2 receptors. This may inhibit angiogenesis and may eventually lead to an inhibition of tumor cell proliferation.
• Sequences: MDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGKGGGGGAQQEECEWDPWTCEHMGSGSATGGSGSTASSGSGSATHQEECEWDPWTCEHMLE
• Species: Human
• Molecular Weight: 63.47 kDa
• Cas No: 894356-79-7
• Formula: C2794H4248N752O886S30
• Endotoxin Level: <0.1 EU per 1 μg of the peptide by the LAL method

Pharmaceutical Information

• Pharmaceutical Application: Trebananib
• Applications: Trebananib is under investigation for the treatment of Ovarian Cancer, Peritoneal Cancer, and Fallopian Tube Cancer. Trebananib has been investigated for the treatment of Cancer, Oncology, Carcinoma, Metastases, and Colon Cancer, among others.
• Examples of Clinical Use: Advanced Solid Tumors / Impaired kidney function / Kidney Diseases
• Targets: ANGPT1; ANGPT2