0
Inquiry Basket
Quote

Thyrotropin alfa; Recombinant thyroid stimulating hormone

Cat# : THP-0005

Product Datasheets COA :
Catalog# Product Name Availability Size Price Qty
THP-0005 Thyrotropin alfa; Recombinant thyroid stimulating hormone June 16, 2024 1 vial $2,998.00
Add to Cart Online Order Request a Bulk Order
Cat#:  THP-0005
Product Name:  Thyrotropin alfa; Recombinant thyroid stimulating hormone
Description:  The product is a recombinant form of thyroid stimulating hormone. It is a heterodimeric glycoprotein comprised of two non-covalently linked subunits, an alpha subunit of 92 amino acid residues containing two N-linked glycosylation sites and a beta subunit of 112 residues containing one N-linked glycosylation site. The alpha subunit is nearly identical to that of human chorionic gonadotropin (hCG), luteinizing hormone (LH), and follicle-stimulating hormone (FSH). The alpha subunit is thought to be the effector region responsible for stimulation of adenylate cyclase (involved the generation of cAMP). The beta subunit (TSHB) is unique to TSH, and therefore determines its receptor specificity. The amino acid sequence of the product is identical to that of human pituitary thyroid stimulating hormone.
Sequences:  Alpha chain APDVQDCPECTLQENPFFSQPGAPILQCMGCCFSRAYPTPLRSKKTMLVQKNVTSESTCC VAKSYNRVTVMGGFKVENHTACHCSTCYYHKS Beta chain FCIPTEYTMHIERRECAYCLTINTTICAGYCMTRDINGKLFLPKYALSQDVCTYRDFIYR TVEIPGCPLHVAPYFSYPVALSCKCGKCNTDYSDCIHEAIKTNYCTKPQKSY
Species:  Human
Molecular Weight:  22672.9 Da
Purity:  >99% by SDS-Page and HPLC analysis
Cas No:  194100-83-9
Formula:  C975H1513N267O304S26
Endotoxin Level:  <0.001 EU per 1 μg of the protein by the LAL method
Biological Activity:  0.9 mg/1mL
For research use only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.

Online Inquiry

  • Size: 100ug 500ug 1mg 5mg 10mg 100mg 500mg 1g
  • Conjugation: None R-PE APC Biotin FITC Alexa Flour Others
CONTACT US

For more information on how our products could help advance your project, please contact us.

Contact Us

ENTER YOUR EMAIL HERE TO SUBSCRIBE.

Copyright © 2024 Creative BioMart. All Rights Reserved.