Sebelipase alfa, Recombinant lysosomal acid lipase (LAL)

Specification

• Cat#: THP-0136
• Product Name: Sebelipase alfa, Recombinant lysosomal acid lipase (LAL)
• Cas No: 1276027-63-4
• Description: The product is active recombinant lysosomal acid lipase (LAL). The amino acid sequence for the product is the same as the amino acid sequence for human LAL.
• Sequences: SGGKLTAVDPETNMNVSEIISYWGFPSEEYLVETEDGYILCLNRIPHGRKNHSDKGPKPVVFLQHGLLADSSNWVTNLANSSLGFILADAGFDVWMGNSRGNTWSRKHKTLSVSQDEFWAFSYDEMAKYDLPASINFILNKTGQEQVYYVGHSQGTTIGFIAFSQIPELAKRIKMFFALGPVASVAFCTSPMAKLGRLPDHLIKDLFGDKEFLPQSAFLKWLGTHVCTHVILKELCGNLCFLLCGFNERNLNMSRVDVYTTHSPAGTSVQNMLHWSQAVKFQKFQAFDWGSSAKNYFHYNQSYPPTYNVKDMLVPTAVWSGGHDWLADVYDVNILLTQITNLVFHESIPEWEHLDFIWGLDAPWRLYNKIINLMRKYQ
• Species: Human
• Molecular Weight: 55000.0 Da
• Purity: >99% by SDS-Page and HPLC analysis
• Formula: C1968H2945N507O551S15
• Endotoxin: <0.001 EU per 1 μg of the protein by the LAL method
• Application: The product is a hydrolytic lysosomal cholesteryl ester and triacylglycerol-specific enzyme indicated for the treatment of patients with a diagnosis of Lysosomal Acid Lipase (LAL) deficiency.
• Concentration: 2 mg/ml

Pharmaceutical Information

• Pharmaceutical Application: Sebelipase alfa