Rituximab

Specification

• Cat#: THA-0001
• Product Name: Rituximab
• Cas No: 174722-31-7
• Description: Rituximab is a genetically engineered chimeric murine/human monoclonal antibody directed against the CD20 antigen found on the surface of normal and malignant B lymphocytes. The antibody is an IgG1 kappa immunoglobulin containing murine light and heavy-chain variable region sequences and human constant region sequences. It was originally approved by the U.S. in 1997 as a single agent to treat patients with B-cell Non-Hodgkin's Lymphoma (NHL), however, has now been approved for a variety of conditions. On November 28, 2018, the US approved Truxima, the first biosimilar to Rituxan (Rituximab).
• Sequences: QVQLQQPGAELVKPGASVKMSCKASGYTFTSYNMHWVKQTPGRGLEWIGAIYPGNGDTSYNQKFKGKATLTADKSSSTAYMQLSSLTSEDSAVYYCARSTYYGGDWYFNVWGAGTTVTVSAASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKAEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
• Molecular Weight: 143859.7 Da
• Formula: C6416H9874N1688O1987S44

Pharmaceutical Information

• Pharmaceutical Application: Riabni
• Targets: B-lymphocyte antigen CD20