Recombinant Interferon Alfa 2a

Specification

• Cat#: THP-0078
• Product Name: Recombinant Interferon Alfa 2a
• Cas No: 76543-88-9
• Description: Interferon a (human leukocyte protein moiety reduced). A type I interferon consisting of 165 amino acid residues with lysine in position 23. This protein is produced by recombinant DNA technology and resembles interferon secreted by leukocytes.
• Sequences: CDLPQTHSLGSRRTLMLLAQMRKISLFSCLKDRHDFGFPQEEFGNQFQKAETIPVLHEMIQQIFNLFSTKDSSAAWDETLLDKFYTELYQQLNDLEACVIQGVGVTETPLMKEDSILAVRKYFQRITLYLKEKKYSPCAWEVVRAEIMRSFSLSTNLQESLRSKE
• Species: Human
• Molecular Weight: 19241.1 Da
• Purity: >99% by SDS-Page and HPLC analysis
• Formula: C860H1353N227O255S9
• Endotoxin: <0.001 EU per 1 μg by the LAL method
• Biological Activity: 6MU/ml
• Application: For the treatment of chronic hepatitis C, hairy cell leukemia, AIDS-related Kaposi's sarcoma, and chronic myelogenous leukemia. Also for the treatment of oral warts arising from HIV infection.

Pharmaceutical Information

• Pharmaceutical Application: Interferon Alfa-2a, Recombinant
• Targets: Target 1. Interferon alpha/beta receptor 1; Target 2. Interferon alpha/beta receptor 2.