0
Inquiry Basket
Quote

Recombinant Interferon Alfa 2a

Cat# : THP-0078

Product Datasheets COA :
Catalog# Product Name Availability Size Price Qty
THP-0078 Recombinant Interferon Alfa 2a April 20, 2024 1 vial $3,998.00
Add to Cart Online Order Request a Bulk Order
Cat#:  THP-0078
Product Name:  Recombinant Interferon Alfa 2a
Description:  Interferon a (human leukocyte protein moiety reduced). A type I interferon consisting of 165 amino acid residues with lysine in position 23. This protein is produced by recombinant DNA technology and resembles interferon secreted by leukocytes.
Sequences:  CDLPQTHSLGSRRTLMLLAQMRKISLFSCLKDRHDFGFPQEEFGNQFQKAETIPVLHEMIQQIFNLFSTKDSSAAWDETLLDKFYTELYQQLNDLEACVIQGVGVTETPLMKEDSILAVRKYFQRITLYLKEKKYSPCAWEVVRAEIMRSFSLSTNLQESLRSKE
Species:  Human
Molecular Weight:  19241.1 Da
Purity:  >99% by SDS-Page and HPLC analysis
Cas No:  76543-88-9
Formula:  C860H1353N227O255S9
Endotoxin Level:  <0.001 EU per 1 μg by the LAL method
Biological Activity:  6MU/ml
For research use only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.

Online Inquiry

  • Size: 100ug 500ug 1mg 5mg 10mg 100mg 500mg 1g
  • Conjugation: None R-PE APC Biotin FITC Alexa Flour Others
CONTACT US

For more information on how our products could help advance your project, please contact us.

Contact Us

ENTER YOUR EMAIL HERE TO SUBSCRIBE.

Copyright © 2024 Creative BioMart. All Rights Reserved.