Recombinant Interferon Alfa 2a

Specification

• Cat#: THP-0078
• Product Name: Recombinant Interferon Alfa 2a
• Description: Interferon a (human leukocyte protein moiety reduced). A type I interferon consisting of 165 amino acid residues with lysine in position 23. This protein is produced by recombinant DNA technology and resembles interferon secreted by leukocytes.
• Sequences: CDLPQTHSLGSRRTLMLLAQMRKISLFSCLKDRHDFGFPQEEFGNQFQKAETIPVLHEMIQQIFNLFSTKDSSAAWDETLLDKFYTELYQQLNDLEACVIQGVGVTETPLMKEDSILAVRKYFQRITLYLKEKKYSPCAWEVVRAEIMRSFSLSTNLQESLRSKE
• Species: Human
• Molecular Weight: 19241.1 Da
• Purity: >99% by SDS-Page and HPLC analysis
• Cas No: 76543-88-9
• Formula: C860H1353N227O255S9
• Endotoxin Level: <0.001 EU per 1 μg by the LAL method
• Biological Activity: 6MU/ml

Pharmaceutical Information

• Pharmaceutical Application: Interferon Alfa-2a, Recombinant
• Applications: For the treatment of chronic hepatitis C, hairy cell leukemia, AIDS-related Kaposi's sarcoma, and chronic myelogenous leukemia. Also for the treatment of oral warts arising from HIV infection.
• Examples of Clinical Use: Chronic hepatitis C, hairy cell leukemia, AIDS-related Kaposi's sarcoma, and chronic myelogenous leukemia.
• Pharmacodynamics: Upregulates the expression of MHC I proteins, allowing for increased presentation of peptides derived from viral antigens. This enhances the activation of CD8+ T cells that are the precursors for cytotoxic T lymphocytes (CTLs) and makes the macrophage a better target for CTL-mediated killing. Interferon alpha also induce the synthesis of several key antiviral mediators, including 2'-5' oligoadenylate synthetase (2'-5' A synthetase) and protein kinase R.
• Mechanism of action: Interferon alpha binds to type I interferon receptors (IFNAR1 and IFNAR2c) which, upon dimerization, activate two Jak (Janus kinase) tyrosine kinases (Jak1 and Tyk2). These transphosphorylate themselves and phosphorylate the receptors. The phosphorylated INFAR receptors then bind to Stat1 and Stat2 (signal transducers and activators of transcription)which dimerize and activate multiple (~100) immunomodulatory and antiviral proteins. Interferon alpha binds less stably to type I interferon receptors than interferon beta.
• Affected organisms: Humans and other mammals
• Targets: Target 1. Interferon alpha/beta receptor 1; Target 2. Interferon alpha/beta receptor 2.