Cat# : THP-0078
Catalog# | Product Name | Availability | Size | Price | Qty |
---|---|---|---|---|---|
THP-0078 | Recombinant Interferon Alfa 2a | January 22, 2025 | 1 vial | $3,998.00 |
|
Add to Cart Online Order Request a Bulk Order |
Cat#: | THP-0078 |
Product Name: | Recombinant Interferon Alfa 2a |
Cas No: | 76543-88-9 |
Description: | Interferon a (human leukocyte protein moiety reduced). A type I interferon consisting of 165 amino acid residues with lysine in position 23. This protein is produced by recombinant DNA technology and resembles interferon secreted by leukocytes. |
Sequences: | CDLPQTHSLGSRRTLMLLAQMRKISLFSCLKDRHDFGFPQEEFGNQFQKAETIPVLHEMIQQIFNLFSTKDSSAAWDETLLDKFYTELYQQLNDLEACVIQGVGVTETPLMKEDSILAVRKYFQRITLYLKEKKYSPCAWEVVRAEIMRSFSLSTNLQESLRSKE |
Species: | Human |
Molecular Weight: | 19241.1 Da |
Purity: | >99% by SDS-Page and HPLC analysis |
Formula: | C860H1353N227O255S9 |
Endotoxin: | <0.001 EU per 1 μg by the LAL method |
Biological Activity: | 6MU/ml |
Application: | For the treatment of chronic hepatitis C, hairy cell leukemia, AIDS-related Kaposi's sarcoma, and chronic myelogenous leukemia. Also for the treatment of oral warts arising from HIV infection. |
For more information on how our products could help advance your project, please contact us.
ENTER YOUR EMAIL HERE TO SUBSCRIBE.
Copyright © 2025 Creative BioMart. All Rights Reserved.