Cat# : THP-0321
Catalog# | Product Name | Availability | Size | Price | Qty |
---|---|---|---|---|---|
THP-0321 | Recombinant Human Tropoelastin | July 08, 2025 | 500ug | $898.00 |
|
1mg | $1,498.00 |
|
Add to Cart Online Order Request a Bulk Order |
Cat#: | THP-0321 |
Product Name: | Recombinant Human Tropoelastin |
Description: | Recombinant Human Tropoelastin is the precursor to elastin, a structural protein made by crosslinking together the water soluble tropoelastin molecules. Elastin provides strength and elasticity and is the main constituent of elastic connective tissue. It allows the tissue to resume its shape after contracting or stretching and is found in the skin, heart, blood vessels, lungs, ligaments, and the bladder. Tropoelastin is supplied as a recombinant lyophilized protein and can be used to coat cell culture surfaces to enhance cell attachment and promote spreading. |
Sequences: | MAGLTAAAPRPGVLLLLLSILHPSRPGGVPGAIPGGVPGGVFYPGAGLGALGGGALGPGGKPLKPVPGGLAGAGLGAGLGAFPAVTFPGALVPGGVADAAAAYKAAKAGAGLGGVPGVGGLGVSAGAVVPQPGAGVKPGKVPGVGLPGVYPGGVLPGARFPGVGVLPGVPTGAGVKPKAPGVGGAFAGIPGVGPFGGPQPGVPLGYPIKAPKLPGGYGLPYTTGKLPYGYGPGGVAGAAGKAGYPTGTGVGPQAAAAAAAKAAAKFGAGAAGVLPGVGGAGVPGVPGAIPGIGGIAGVGTPAAAAAAAAAAKAAKYGAAAGLVPGGPGFGPGVVGVPGAGVPGVGVPGAGIPVVPGAGIPGAAVPGVVSPEAAAKAAAKAAKYGARPGVGVGGIPTYGVGAGGFPGFGVGVGGIPGVAGVPSVGGVPGVGGVPGVGISPEAQAAAAAKAAKYGLVPGVGVAPGVGVAPGVGVAPGVGLAPGVGVAPGVGVAPGVGVAPGIGPGGVAAAAKSAAKVAAKAQLRAAAGLGAGIPGLGVGVGVPGLGVGAGVPGLGVGAGVPGFGAVPGALAAAKAAKYGAAVPGVLGGLGALGGVGIPGGVVGAGPAAAAAAAKAAAKAAQFGLVGAAGLGGLGVGGLGVPGVGGLGGIPPAAAAKAAKYGVAARPGFGLSPIFPGGACLGKACGRKRK |
Species: | Human |
Molecular Weight: | 72 kDa |
Source: | E.coli |
Application: | Used as a cell culture surface coating, tropoelastin can promote cell attachment and spreading. Tropoelastin also allows the modulation of surface elasticity which can have significant effects on cell growth and function. |
For more information on how our products could help advance your project, please contact us.
ENTER YOUR EMAIL HERE TO SUBSCRIBE.
Copyright © 2025 Creative BioMart. All Rights Reserved.