0
Inquiry Basket
Quote

Recombinant Human Erythropoietin

Cat# : THP-0067

Product Datasheets COA :
Catalog# Product Name Availability Size Price Qty
THP-0067 Recombinant Human Erythropoietin August 27, 2025 1 vial $3,998.00
Add to Cart Online Order Request a Bulk Order
Cat#:  THP-0067
Product Name:  Recombinant Human Erythropoietin
Cas No:  11096-26-7
Description:  The product is a growth factor produced in the kidneys that stimulates the production of red blood cells. It works by promoting the division and differentiation of committed erythroid progenitors in the bone marrow. It is a 165-amino acid erythropoiesis-stimulating glycoprotein produced in cell culture using recombinant DNA technology. It has a molecular weight of approximately 30,400 daltons and is produced by mammalian cells into which the human growth factor gene has been introduced. The product contains the identical amino acid sequence of isolated natural product and has the same biological activity as the endogenous the product.
Sequences:  APPRLICDSRVLERYLLEAKEAENITTGCAEHCSLNENITVPDTKVNFYAWKRMEVGQQAVEVWQGLALLSEAVLRGQALLVNSSQPWEPLQLHVDKAVSGLRSLTTLLRALGAQKEAISPPDAASAAPLRTITADTFRKLFRVYSNFLRGKLKLYTGEACRTGDR
Species:  Human
Molecular Weight:  18396.1 Da
Source:  Mammalian cells
Purity:  >99% by SDS-Page and HPLC analysis
Formula:  C815H1317N233O241S5
Endotoxin:  <0.001 EU per 1 μg of the protein by the LAL method
Biological Activity:  8000IU/0.8ml
Application:  Indicated in adult and paediatric patients for the: treatment of anemia due to Chronic Kidney Disease (CKD) in patients on dialysis and not on dialysis.treatment of anemia due to zidovudine in patients with HIV-infection. treatment of anemia due to the effects of concomitant myelosuppressive chemotherapy, and upon initiation, there is a minimum of two additional months of planned chemotherapy.reduction of allogeneic RBC transfusions in patients undergoing elective, noncardiac, nonvascular surgery.
Not For Human Consumption!

Online Inquiry

  • Size: 100ug 500ug 1mg 5mg 10mg 100mg 500mg 1g
  • Conjugation: None R-PE APC Biotin FITC Alexa Flour Others
CONTACT US

For more information on how our products could help advance your project, please contact us.

Contact Us

ENTER YOUR EMAIL HERE TO SUBSCRIBE.

Copyright © 2025 Creative BioMart. All Rights Reserved.