Cat# : THP-0067
Catalog# | Product Name | Availability | Size | Price | Qty |
---|---|---|---|---|---|
THP-0067 | Recombinant Human Erythropoietin | July 27, 2024 | 1 vial | $3,998.00 |
|
Add to Cart Online Order Request a Bulk Order |
Cat#: | THP-0067 |
Product Name: | Recombinant Human Erythropoietin |
Description: | The product is a growth factor produced in the kidneys that stimulates the production of red blood cells. It works by promoting the division and differentiation of committed erythroid progenitors in the bone marrow. It is a 165-amino acid erythropoiesis-stimulating glycoprotein produced in cell culture using recombinant DNA technology. It has a molecular weight of approximately 30,400 daltons and is produced by mammalian cells into which the human growth factor gene has been introduced. The product contains the identical amino acid sequence of isolated natural product and has the same biological activity as the endogenous the product. |
Sequences: | APPRLICDSRVLERYLLEAKEAENITTGCAEHCSLNENITVPDTKVNFYAWKRMEVGQQAVEVWQGLALLSEAVLRGQALLVNSSQPWEPLQLHVDKAVSGLRSLTTLLRALGAQKEAISPPDAASAAPLRTITADTFRKLFRVYSNFLRGKLKLYTGEACRTGDR |
Species: | Human |
Molecular Weight: | 18396.1 Da |
Source: | Mammalian cells |
Purity: | >99% by SDS-Page and HPLC analysis |
Cas No: | 11096-26-7 |
Formula: | C815H1317N233O241S5 |
Endotoxin Level: | <0.001 EU per 1 μg of the protein by the LAL method |
Biological Activity: | 8000IU/0.8ml |
For more information on how our products could help advance your project, please contact us.
ENTER YOUR EMAIL HERE TO SUBSCRIBE.
Copyright © 2024 Creative BioMart. All Rights Reserved.