Pegfilgrastim, PEGylated Human granulocyte colony stimulating factor (GCSF)

Specification

• Cat#: THP-0174
• Product Name: Pegfilgrastim, PEGylated Human granulocyte colony stimulating factor (GCSF)
• Cas No: 208265-92-3
• Description: The product is a PEGylated form of filgrastim(Human GCSF) at the N terminus. Due to a longer half-life and slower elimination rate than filgrastim, pegfilgrastim requires less frequent dosing than filgrastim. However, pegfilgrastim retains the same biological activity as filgrastim and binds to the same G-CSF receptor to stimulate the proliferation, differentiation, and activation of neutrophils.
• Sequences: MTPLGPASSLPQSFLLKCLEQVRKIQGDGAALQEKLCATYKLCHPEELVLLGHSLGIPWAPLSSCPSQALQLAGCLSQLHSGLFLYQGLLQALEGISPELGPTLDTLQLDVADFATTIWQQMEELGMAPALQPTQGAMPAFASAFQRRAGGVLVASHLQSFLEVSYRVLRHLAQP
• Species: Human
• Molecular Weight: 18802.8 Da
• Source: E. coli
• Formula: C845H1343N223O243S9
• Endotoxin: <0.001 EU per 1 μg of the peptide by the LAL method
• Application: The product is indicated for use in patients receiving myelosuppressive chemotherapy for non-myeloid malignancies to reduce the incidence of infection.
• Concentration: 10mg/ml

Pharmaceutical Information

• Pharmaceutical Application: Pegfilgrastim
• Targets: Target 1. Granulocyte colony-stimulating factor receptor; Target 2. Neutrophil elastase