Cat# : THP-0174
Catalog# | Product Name | Availability | Size | Price | Qty |
---|---|---|---|---|---|
THP-0174 | Pegfilgrastim, PEGylated Human granulocyte colony stimulating factor (GCSF) | June 01, 2025 | 100ug | $998.00 |
|
1mg | $3,998.00 |
|
Add to Cart Online Order Request a Bulk Order |
Cat#: | THP-0174 |
Product Name: | Pegfilgrastim, PEGylated Human granulocyte colony stimulating factor (GCSF) |
Cas No: | 208265-92-3 |
Description: | The product is a PEGylated form of filgrastim(Human GCSF) at the N terminus. Due to a longer half-life and slower elimination rate than filgrastim, pegfilgrastim requires less frequent dosing than filgrastim. However, pegfilgrastim retains the same biological activity as filgrastim and binds to the same G-CSF receptor to stimulate the proliferation, differentiation, and activation of neutrophils. |
Sequences: | MTPLGPASSLPQSFLLKCLEQVRKIQGDGAALQEKLCATYKLCHPEELVLLGHSLGIPWAPLSSCPSQALQLAGCLSQLHSGLFLYQGLLQALEGISPELGPTLDTLQLDVADFATTIWQQMEELGMAPALQPTQGAMPAFASAFQRRAGGVLVASHLQSFLEVSYRVLRHLAQP |
Species: | Human |
Molecular Weight: | 18802.8 Da |
Source: | E. coli |
Formula: | C845H1343N223O243S9 |
Endotoxin: | <0.001 EU per 1 μg of the peptide by the LAL method |
Application: | The product is indicated for use in patients receiving myelosuppressive chemotherapy for non-myeloid malignancies to reduce the incidence of infection. |
Concentration: | 10mg/ml |
For more information on how our products could help advance your project, please contact us.
ENTER YOUR EMAIL HERE TO SUBSCRIBE.
Copyright © 2025 Creative BioMart. All Rights Reserved.