0
Inquiry Basket
Check Out

Pegfilgrastim, PEGylated Human granulocyte colony stimulating factor (GCSF)

Cat# : THP-0174

Product Datasheets COA :
Catalog#Product NameAvailabilitySizePriceQty
THP-0174 Pegfilgrastim, PEGylated Human granulocyte colony stimulating factor (GCSF) June 05, 2023 1 vial $3,998.00
Add to Cart Online Order Request a Bulk Order
Cat#:  THP-0174
Product Name:  Pegfilgrastim, PEGylated Human granulocyte colony stimulating factor (GCSF)
Description:  The product is a PEGylated form of filgrastim(Human GCSF) at the N terminus. Due to a longer half-life and slower elimination rate than filgrastim, pegfilgrastim requires less frequent dosing than filgrastim. However, pegfilgrastim retains the same biological activity as filgrastim and binds to the same G-CSF receptor to stimulate the proliferation, differentiation, and activation of neutrophils.
Sequences:  MTPLGPASSLPQSFLLKCLEQVRKIQGDGAALQEKLCATYKLCHPEELVLLGHSLGIPWAPLSSCPSQALQLAGCLSQLHSGLFLYQGLLQALEGISPELGPTLDTLQLDVADFATTIWQQMEELGMAPALQPTQGAMPAFASAFQRRAGGVLVASHLQSFLEVSYRVLRHLAQP
Species:  Human
Molecular Weight:  18802.8 Da
Source:  E. coli
Cas No:  208265-92-3
Formula:  C845H1343N223O243S9
Endotoxin Level:  <0.001 EU per 1 μg of the peptide by the LAL method
Biological Activity:  10mg/ml
For research use only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.

Online Inquiry

  • Size: 100ug 500ug 1mg 5mg 10mg 100mg 500mg 1g
  • Conjugation: None R-PE APC Biotin FITC Alexa Flour Others
CONTACT US

For more information on how our products could help advance your project, please contact us.

Contact Us

ENTER YOUR EMAIL HERE TO SUBSCRIBE.

Copyright © Creative BioMart. All Rights Reserved.