0
Inquiry Basket
Quote

Nepidermin, Recombinant human epidermal growth factor (rhEGF)

Cat# : THP-0303

Product Datasheets COA :
Catalog# Product Name Availability Size Price Qty
THP-0303 Nepidermin, Recombinant human epidermal growth factor (rhEGF) October 08, 2024 1 vial $3,998.00
Add to Cart Online Order Request a Bulk Order
Cat#:  THP-0303
Product Name:  Nepidermin, Recombinant human epidermal growth factor (rhEGF)
Cas No:  62253-63-8
Description:  Nepidermin, also known as recombinant human epidermal growth factor (rhEGF), is a recombinant form of human epidermal growth factor (EGF) and a cicatrizant (a drug that promotes wound healing through formation of scar tissue). As a recombinant form of EGF, nepidermin is an agonist of the epidermal growth factor receptor (EGFR), and is the first EGFR agonist to be marketed.
Sequences:  NSDSECPLSHDGYCLHDGVCMYIEALDKYACNCVVGYIGERCQYRDLKWWELR
Species:  Human
Purity:  >99% by SDS-Page and HPLC analysis
Formula:  C270H401N73O83S7
Endotoxin:  <0.1 EU per 1 μg of the peptide by the LAL method
Application:  Upon topical application, recombinant human epidermal growth factor (rhEGF) may stimulate epithelial proliferation, differentiation and migration, which may result in the acceleration of epithelial regeneration and wound healing. In addition, rhEGF may attenuate epithelial cytotoxicities related to chemotherapy and/or radiotherapy.
For research use only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.

Online Inquiry

  • Size: 100ug 500ug 1mg 5mg 10mg 100mg 500mg 1g
  • Conjugation: None R-PE APC Biotin FITC Alexa Flour Others
CONTACT US

For more information on how our products could help advance your project, please contact us.

Contact Us

ENTER YOUR EMAIL HERE TO SUBSCRIBE.

Copyright © 2024 Creative BioMart. All Rights Reserved.