Cat# : THP-0303
Catalog# | Product Name | Availability | Size | Price | Qty |
---|---|---|---|---|---|
THP-0303 | Nepidermin, Recombinant human epidermal growth factor (rhEGF) | April 05, 2025 | 1 vial | $3,998.00 |
|
Add to Cart Online Order Request a Bulk Order |
Cat#: | THP-0303 |
Product Name: | Nepidermin, Recombinant human epidermal growth factor (rhEGF) |
Cas No: | 62253-63-8 |
Description: | Nepidermin, also known as recombinant human epidermal growth factor (rhEGF), is a recombinant form of human epidermal growth factor (EGF) and a cicatrizant (a drug that promotes wound healing through formation of scar tissue). As a recombinant form of EGF, nepidermin is an agonist of the epidermal growth factor receptor (EGFR), and is the first EGFR agonist to be marketed. |
Sequences: | NSDSECPLSHDGYCLHDGVCMYIEALDKYACNCVVGYIGERCQYRDLKWWELR |
Species: | Human |
Purity: | >99% by SDS-Page and HPLC analysis |
Formula: | C270H401N73O83S7 |
Endotoxin: | <0.1 EU per 1 μg of the peptide by the LAL method |
Application: | Upon topical application, recombinant human epidermal growth factor (rhEGF) may stimulate epithelial proliferation, differentiation and migration, which may result in the acceleration of epithelial regeneration and wound healing. In addition, rhEGF may attenuate epithelial cytotoxicities related to chemotherapy and/or radiotherapy. |
For more information on how our products could help advance your project, please contact us.
ENTER YOUR EMAIL HERE TO SUBSCRIBE.
Copyright © 2025 Creative BioMart. All Rights Reserved.