Nepidermin, Recombinant human epidermal growth factor (rhEGF)

Specification

• Cat#: THP-0303
• Product Name: Nepidermin, Recombinant human epidermal growth factor (rhEGF)
• Description: Nepidermin, also known as recombinant human epidermal growth factor (rhEGF), is a recombinant form of human epidermal growth factor (EGF) and a cicatrizant (a drug that promotes wound healing through formation of scar tissue). As a recombinant form of EGF, nepidermin is an agonist of the epidermal growth factor receptor (EGFR), and is the first EGFR agonist to be marketed.
• Sequences: NSDSECPLSHDGYCLHDGVCMYIEALDKYACNCVVGYIGERCQYRDLKWWELR
• Species: Human
• Purity: >99% by SDS-Page and HPLC analysis
• Cas No: 62253-63-8
• Formula: C270H401N73O83S7
• Endotoxin Level: <0.1 EU per 1 μg of the peptide by the LAL method

Pharmaceutical Information

• Pharmaceutical Application: Nepidermin
• Applications: Upon topical application, recombinant human epidermal growth factor (rhEGF) may stimulate epithelial proliferation, differentiation and migration, which may result in the acceleration of epithelial regeneration and wound healing. In addition, rhEGF may attenuate epithelial cytotoxicities related to chemotherapy and/or radiotherapy.
• Examples of Clinical Use: Oral Mucositis; Colorectal Cancers