Cat# : THP-0134
| Catalog# | Product Name | Availability | Size | Price | Qty |
|---|---|---|---|---|---|
| THP-0134 | Metreleptin, Recombinant Leptin | December 03, 2024 | 1 vial | $3,998.00 |
|
| Add to Cart Online Order Request a Bulk Order | |||||
| Cat#: | THP-0134 |
| Product Name: | Metreleptin, Recombinant Leptin |
| Cas No: | 186018-45-1 |
| Description: | The product is a recombinant human hormone leptin. The product is expressed in E. coli and differs from native human leptin by the addition of a methionine residue at its amino terminus. |
| Sequences: | MVPIQKVQDDTKTLIKTIVTRINDISHTQSVSSKQKVTGLDFIPGLHPILTLSKMDQTLAVYQQILTSMPSRNVIQISNDLENLRDLLHVLAFSKSCHLPWASGLETLDSLGGVLEASGYSTEVVALSRLQGSLQDMLWQLDLSPGC |
| Species: | Human |
| Molecular Weight: | 16155.4429 Da |
| Source: | E. coli |
| Purity: | >99% by SDS-Page and HPLC analysis |
| Formula: | C714H1167N191O221S6 |
| Endotoxin: | <0.001 EU per 1 μg of the protein by the LAL method |
| Application: | The product is indicated as an adjunct to diet as replacement therapy to treat the complications of leptin deficiency in patients with congenital or acquired generalized lipodystrophy. |
| Concentration: | 11.3 mg/2.2mL |
For more information on how our products could help advance your project, please contact us.
ENTER YOUR EMAIL HERE TO SUBSCRIBE.
Copyright © 2024 Creative BioMart. All Rights Reserved.
