Metreleptin, Recombinant Leptin

Specification

• Cat#: THP-0134
• Product Name: Metreleptin, Recombinant Leptin
• Description: The product is a recombinant human hormone leptin. The product is expressed in E. coli and differs from native human leptin by the addition of a methionine residue at its amino terminus.
• Sequences: MVPIQKVQDDTKTLIKTIVTRINDISHTQSVSSKQKVTGLDFIPGLHPILTLSKMDQTLAVYQQILTSMPSRNVIQISNDLENLRDLLHVLAFSKSCHLPWASGLETLDSLGGVLEASGYSTEVVALSRLQGSLQDMLWQLDLSPGC
• Species: Human
• Molecular Weight: 16155.4429 Da
• Source: E. coli
• Purity: >99% by SDS-Page and HPLC analysis
• Cas No: 186018-45-1
• Formula: C714H1167N191O221S6
• Endotoxin Level: <0.001 EU per 1 μg of the protein by the LAL method
• Biological Activity: 11.3 mg/2.2mL

Pharmaceutical Information

• Pharmaceutical Application: Metreleptin
• Applications: The product is indicated as an adjunct to diet as replacement therapy to treat the complications of leptin deficiency in patients with congenital or acquired generalized lipodystrophy.
• Examples of Clinical Use: Congenital or acquired generalized lipodystrophy
• Pharmacodynamics: In patients with leptin deficiency, clinical trials demonstrated that exogenous leptin administration results in weight loss, reduction in mean HbA1c and fasting glucose levels, reduced blood insulin, and reduced triglyceride levels leading to improved insulin sensitivity and reductions in food intake.
• Mechanism of action: Metreleptin functions by binding to and activating the human leptin receptor (ObR), which belongs to the Class I cytokine family of receptors that signals through the JAK/STAT transduction pathway.
• Affected organisms: Humans and other mammals
• Targets: Target 1. Leptin receptor