Cat# : THP-0032
Catalog# | Product Name | Availability | Size | Price | Qty |
---|---|---|---|---|---|
THP-0032 | Mecasermin; Recombinant human insulin-like growth factor-1 (rhIGF-1) | November 21, 2024 | 10mg | $3,998.00 |
|
500ug | $329.00 |
|
|||
Add to Cart Online Order Request a Bulk Order |
Cat#: | THP-0032 |
Product Name: | Mecasermin; Recombinant human insulin-like growth factor-1 (rhIGF-1) |
Cas No: | 68562-41-4 |
Description: | The product contains recombinant-DNA-engineered human insulin-like growth factor-1 (rhIGF-1). IGF-1 consists of 70 amino acids in a single chain with three intramolecular disulfide bridges and a molecular weight of 7649 daltons. The amino acid sequence of the product is identical to that of endogenous human IGF-1. The rhIGF-1 protein is synthesized in bacteria (E. coli) that have been modified by the addition of the gene for human IGF-1. |
Sequences: | GPETLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSA |
Species: | Human |
Molecular Weight: | 7649.0 Da |
Source: | E. coli |
Purity: | >99% by SDS-Page and HPLC analysis |
Formula: | C331H518N94O101S7 |
Endotoxin: | <0.001 EU per 1 μg of the peptide by the LAL method |
Application: | For the long-term treatment of growth failure in pediatric patients with Primary IGFD or with GH gene deletion who have developed neutralizing antibodies to GH. It is not indicated to treat Secondary IGFD resulting from GH deficiency, malnutrition, hypothyroidism or other causes; it is not a substitute for GH therapy. |
Concentration: | 10 mg/ml |
For more information on how our products could help advance your project, please contact us.
ENTER YOUR EMAIL HERE TO SUBSCRIBE.
Copyright © 2024 Creative BioMart. All Rights Reserved.