Cat# : THP-0032
Catalog# | Product Name | Availability | Size | Price | Qty |
---|---|---|---|---|---|
THP-0032 | Mecasermin; Recombinant human insulin-like growth factor-1 (rhIGF-1) | November 28, 2023 | 10mg | $3,998.00 |
|
Add to Cart Online Order Request a Bulk Order | |||||
THP-0032 | Mecasermin; Recombinant human insulin-like growth factor-1 (rhIGF-1) | November 28, 2023 | 500ug | $329.00 |
|
Add to Cart Online Order Request a Bulk Order |
Cat#: | THP-0032 |
Product Name: | Mecasermin; Recombinant human insulin-like growth factor-1 (rhIGF-1) |
Description: | The product contains recombinant-DNA-engineered human insulin-like growth factor-1 (rhIGF-1). IGF-1 consists of 70 amino acids in a single chain with three intramolecular disulfide bridges and a molecular weight of 7649 daltons. The amino acid sequence of the product is identical to that of endogenous human IGF-1. The rhIGF-1 protein is synthesized in bacteria (E. coli) that have been modified by the addition of the gene for human IGF-1. |
Sequences: | GPETLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSA |
Species: | Human |
Molecular Weight: | 7649.0 Da |
Source: | E. coli |
Purity: | >99% by SDS-Page and HPLC analysis |
Cas No: | 68562-41-4 |
Formula: | C331H518N94O101S7 |
Endotoxin Level: | <0.001 EU per 1 μg of the peptide by the LAL method |
Biological Activity: | 10 mg/ml |
For more information on how our products could help advance your project, please contact us.
ENTER YOUR EMAIL HERE TO SUBSCRIBE.
Copyright © 2023 Creative BioMart. All Rights Reserved.