0
Inquiry Basket
Quote

Mecasermin; Recombinant human insulin-like growth factor-1 (rhIGF-1)

Cat# : THP-0032

Product Datasheets COA :
Catalog# Product Name Availability Size Price Qty
THP-0032 Mecasermin; Recombinant human insulin-like growth factor-1 (rhIGF-1) April 26, 2024 10mg $3,998.00
500ug $329.00
Add to Cart Online Order Request a Bulk Order
Cat#:  THP-0032
Product Name:  Mecasermin; Recombinant human insulin-like growth factor-1 (rhIGF-1)
Description:  The product contains recombinant-DNA-engineered human insulin-like growth factor-1 (rhIGF-1). IGF-1 consists of 70 amino acids in a single chain with three intramolecular disulfide bridges and a molecular weight of 7649 daltons. The amino acid sequence of the product is identical to that of endogenous human IGF-1. The rhIGF-1 protein is synthesized in bacteria (E. coli) that have been modified by the addition of the gene for human IGF-1.
Sequences:  GPETLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSA
Species:  Human
Molecular Weight:  7649.0 Da
Source:  E. coli
Purity:  >99% by SDS-Page and HPLC analysis
Cas No:  68562-41-4
Formula:  C331H518N94O101S7
Endotoxin Level:  <0.001 EU per 1 μg of the peptide by the LAL method
Biological Activity:  10 mg/ml
For research use only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.

Online Inquiry

  • Size: 100ug 500ug 1mg 5mg 10mg 100mg 500mg 1g
  • Conjugation: None R-PE APC Biotin FITC Alexa Flour Others
CONTACT US

For more information on how our products could help advance your project, please contact us.

Contact Us

ENTER YOUR EMAIL HERE TO SUBSCRIBE.

Copyright © 2024 Creative BioMart. All Rights Reserved.