Mecasermin; Recombinant human insulin-like growth factor-1 (rhIGF-1)

Specification

• Cat#: THP-0032
• Product Name: Mecasermin; Recombinant human insulin-like growth factor-1 (rhIGF-1)
• Description: The product contains recombinant-DNA-engineered human insulin-like growth factor-1 (rhIGF-1). IGF-1 consists of 70 amino acids in a single chain with three intramolecular disulfide bridges and a molecular weight of 7649 daltons. The amino acid sequence of the product is identical to that of endogenous human IGF-1. The rhIGF-1 protein is synthesized in bacteria (E. coli) that have been modified by the addition of the gene for human IGF-1.
• Sequences: GPETLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSA
• Species: Human
• Molecular Weight: 7649.0 Da
• Source: E. coli
• Purity: >99% by SDS-Page and HPLC analysis
• Cas No: 68562-41-4
• Formula: C331H518N94O101S7
• Endotoxin Level: <0.001 EU per 1 μg of the peptide by the LAL method
• Biological Activity: 10 mg/ml

Pharmaceutical Information

• Pharmaceutical Application: Mecasermin
• Applications: For the long-term treatment of growth failure in pediatric patients with Primary IGFD or with GH gene deletion who have developed neutralizing antibodies to GH. It is not indicated to treat Secondary IGFD resulting from GH deficiency, malnutrition, hypothyroidism or other causes; it is not a substitute for GH therapy.
• Examples of Clinical Use: Growth failure in pediatric patients with Primary IGFD or with GH gene deletion
• Pharmacodynamics: The product is a biosynthetic (recombinant DNA origin) form of human insulin growth factor 1 (IGF-1) designed to replace natural IGF-1 in pediatric patients who are deficient, promoting normalized statural growth. Growth hormones (GH) bind to growth hormone receptors (GHR) in the liver and other tissues, which stimulates the synthesis of IGF-1. In target tissues, IGF-1 activates the IGF-1 receptor, resulting in intracellular signals that stimulate growth. Although many actions of the GH are mediated through IGF-1, the precise roles of GH and IGF-1 have not been fully elucidated. Patients with severe primary IGF-1 deficiency (Primary IGFD) fail to produce adequate levels of IGF-1, due to disruption of the GH pathway used to promote IGF-1 release (possible GH pathway disruptions include mutations in the GHR, post-GHR signaling pathway, and IGF-1 gene defects).
• Mechanism of action: Mecasermin supplies recombinant-DNA-origin IGF-1, which binds to the Type I IGF-1 receptor. This receptor exerts intra-cellular signaling activity in a number of processes involved in statural growth, including mitogenesis in multiple tissue types, chondrocyte growth and division along cartilage growth plates, and increases in organ growth.
• Affected organisms: Humans and other mammals
• Targets: Target 1. Insulin-like growth factor 1 receptor; Target 2. Insulin-like growth factor-binding protein 3; Target 3. Insulin receptor; Target 4. Cation-independent mannose-6-phosphate receptor