Cat# : THP-0133
| Catalog# | Product Name | Availability | Size | Price | Qty |
|---|---|---|---|---|---|
| THP-0133 | Liraglutide, GLP-1 peptide | February 09, 2026 | 1 vial | $3,998.00 |
|
| Add to Cart Online Order Request a Bulk Order |
| Cat#: | THP-0133 |
| Product Name: | Liraglutide, GLP-1 peptide |
| Cas No: | 204656-20-2 |
| Description: | This peptide is a synthetic analog of human glucagon-like peptide-1(GLP-1) and acts as a GLP-1 receptor agonist. It is 97% homologous to native human GLP-1 by substituting arginine for lysine at position 341 and is made by attaching a C-16 fatty acid (palmitic acid) with a glutamic acid spacer on the remaining lysine residue at position 26 of the peptide precursor. |
| Sequences: | HAEGTFTSDVSSYLEGQAAKEEFIAWLVRGRG |
| Species: | Human |
| Molecular Weight: | 3751.2 Da |
| Purity: | >99% by SDS-Page and HPLC analysis |
| Formula: | C172H265N43O51 |
| Endotoxin: | <0.001 EU per 1 μg of the protein by the LAL method |
| Application: | For use in/treatment of diabetes mellitus type 2. |
| Concentration: | 6 mg/ml |
For more information on how our products could help advance your project, please contact us.
ENTER YOUR EMAIL HERE TO SUBSCRIBE.
Copyright © 2026 Creative BioMart. All Rights Reserved.