0
Inquiry Basket
Check Out

Liraglutide, GLP-1 peptide

Cat# : THP-0133

Product Datasheets COA :
Catalog# Product Name Availability Size Price Qty
THP-0133 Liraglutide, GLP-1 peptide October 01, 2023 1 vial $3,998.00
Add to Cart Online Order Request a Bulk Order
Cat#:  THP-0133
Product Name:  Liraglutide, GLP-1 peptide
Description:  This peptide is a synthetic analog of human glucagon-like peptide-1(GLP-1) and acts as a GLP-1 receptor agonist. It is 97% homologous to native human GLP-1 by substituting arginine for lysine at position 341 and is made by attaching a C-16 fatty acid (palmitic acid) with a glutamic acid spacer on the remaining lysine residue at position 26 of the peptide precursor.
Sequences:  HAEGTFTSDVSSYLEGQAAKEEFIAWLVRGRG
Species:  Human
Molecular Weight:  3751.2 Da
Purity:  >99% by SDS-Page and HPLC analysis
Cas No:  204656-20-2
Formula:  C172H265N43O51
Endotoxin Level:  <0.001 EU per 1 μg of the protein by the LAL method
Biological Activity:  6 mg/ml
For research use only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.

Online Inquiry

  • Size: 100ug 500ug 1mg 5mg 10mg 100mg 500mg 1g
  • Conjugation: None R-PE APC Biotin FITC Alexa Flour Others
CONTACT US

For more information on how our products could help advance your project, please contact us.

Contact Us

ENTER YOUR EMAIL HERE TO SUBSCRIBE.

Copyright © 2023 Creative BioMart. All Rights Reserved.