Cat# : THP-0133
Catalog# | Product Name | Availability | Size | Price | Qty |
---|---|---|---|---|---|
THP-0133 | Liraglutide, GLP-1 peptide | May 09, 2025 | 1 vial | $3,998.00 |
|
Add to Cart Online Order Request a Bulk Order |
Cat#: | THP-0133 |
Product Name: | Liraglutide, GLP-1 peptide |
Cas No: | 204656-20-2 |
Description: | This peptide is a synthetic analog of human glucagon-like peptide-1(GLP-1) and acts as a GLP-1 receptor agonist. It is 97% homologous to native human GLP-1 by substituting arginine for lysine at position 341 and is made by attaching a C-16 fatty acid (palmitic acid) with a glutamic acid spacer on the remaining lysine residue at position 26 of the peptide precursor. |
Sequences: | HAEGTFTSDVSSYLEGQAAKEEFIAWLVRGRG |
Species: | Human |
Molecular Weight: | 3751.2 Da |
Purity: | >99% by SDS-Page and HPLC analysis |
Formula: | C172H265N43O51 |
Endotoxin: | <0.001 EU per 1 μg of the protein by the LAL method |
Application: | For use in/treatment of diabetes mellitus type 2. |
Concentration: | 6 mg/ml |
For more information on how our products could help advance your project, please contact us.
ENTER YOUR EMAIL HERE TO SUBSCRIBE.
Copyright © 2025 Creative BioMart. All Rights Reserved.