Liraglutide, GLP-1 peptide

Specification

• Cat#: THP-0133
• Product Name: Liraglutide, GLP-1 peptide
• Cas No: 204656-20-2
• Description: This peptide is a synthetic analog of human glucagon-like peptide-1(GLP-1) and acts as a GLP-1 receptor agonist. It is 97% homologous to native human GLP-1 by substituting arginine for lysine at position 341 and is made by attaching a C-16 fatty acid (palmitic acid) with a glutamic acid spacer on the remaining lysine residue at position 26 of the peptide precursor.
• Sequences: HAEGTFTSDVSSYLEGQAAKEEFIAWLVRGRG
• Species: Human
• Molecular Weight: 3751.2 Da
• Purity: >99% by SDS-Page and HPLC analysis
• Formula: C172H265N43O51
• Endotoxin: <0.001 EU per 1 μg of the protein by the LAL method
• Application: For use in/treatment of diabetes mellitus type 2.
• Concentration: 6 mg/ml

Pharmaceutical Information

• Pharmaceutical Application: Liraglutide
• Targets: Target 1. Glucagon-like peptide 1 receptor; Enzyme 1. Dipeptidyl peptidase 4; Enzyme 2. Neprilysin