Cat# : THP-0132
Catalog# | Product Name | Availability | Size | Price | Qty |
---|---|---|---|---|---|
THP-0132 | Laronidase, Recombinant Human IDUA | January 22, 2025 | 5ug | $298.00 |
|
10ug | $398.00 |
|
|||
50ug | $998.00 |
|
|||
1mg | $3,998.00 |
|
|||
Add to Cart Online Order Request a Bulk Order |
Cat#: | THP-0132 |
Product Name: | Laronidase, Recombinant Human IDUA |
Cas No: | 210589-09-6 |
Description: | Human recombinant alpha-L-iduronidase(IDUA) encodes 628a.a.(mature form) and is expressed in a CHO cell line. The product is a glycoprotein with a molecular weight of approximately 83 kD. The predicted amino acid sequence of the recombinant form, as well as the nucleotide sequence that encodes it, is identical to a polymorphic form of human a-L-iduronidase. It contains 6 N-linked oligosaccharide modification sites. |
Sequences: | APHLVQVDAARALWPLRRFWRSTGFCPPLPHSQADQYVLSWDQQLNLAYVGAVPHRGIKQVRTHWLLELVTTRGSTGRGLSYNFTHLDGYLDLLRENQLLPGFELMGSASGHFTDFEDKQQVFEWKDLVSSLARRYIGRYGLAHVSKWNFETWNEPDHHDFDNVSMTMQGFLNYYDACSEGLRAASPALRLGGPGDSFHTPPRSPLSWGLLRHCHDGTNFFTGEAGVRLDYISLHRKGARSSISILEQEKVVAQQIRQLFPKFADTPIYNDEADPLVGWSLPQPWRADVTYAAMVVKVIAQHQNLLLANTTSAFPYALLSNDNAFLSYHPHPFAQRTLTARFQVNNTRPPHVQLLRKPVLTAMGLLALLDEEQLWAEVSQAGTVLDSNHTVGVLASAHRPQGPADAWRAAVLIYASDDTRAHPNRSVAVTLRLRGVPPGPGLVYVTRYLDNGLCSPDGEWRRLGRPVFPTAEQFRRMRAAEDPVAAAPRPLPAGGRLTLRPALRLPSLLLVHVCARPEKPPGQVTRLRALPLTQGQLVLVWSDEHVGSKCLWTYEIQFSQDGKAYTPVSRKPSTFNLFVFSPDTGAVSGSYRVRALDYWARPGPFSDPVPYLEVPVPRGPPSPGNP |
Species: | Human |
Molecular Weight: | 69899.4 Da |
Source: | CHO |
Purity: | >99% by SDS-Page and HPLC analysis |
Formula: | C3160H4848N898O881S12 |
Endotoxin: | <0.001 EU per 1 μg of the protein by the LAL method |
Biological Activity: | 100IU/ml |
Application: | For the treatment of mucopolysaccharidosis |
For more information on how our products could help advance your project, please contact us.
ENTER YOUR EMAIL HERE TO SUBSCRIBE.
Copyright © 2025 Creative BioMart. All Rights Reserved.