Interferon beta-1b

Specification

• Cat#: THP-0103
• Product Name: Interferon beta-1b
• Cas No: 145155-23-3
• Description: Human interferon beta (165 residues), cysteine 17 is substituted with serine. Produced in E. coli, no carbohydrates, MW=18.5kD
• Sequences: SYNLLGFLQRSSNFQSQKLLWQLNGRLEYCLKDRMNFDIPEEIKQLQQFQKEDAALTIYEMLQNIFAIFRQDSSSTGWNETIVENLLANVYHQINHLKTVLEEKLEKEDFTRGKLMSSLHLKRYYGRILHYLKAKEYSHCAWTIVRVEILRNFYFINRLTGYLRN
• Species: Human
• Molecular Weight: 20011.0 Da
• Source: E. coli
• Purity: >99% by SDS-Page and HPLC analysis
• Formula: C908H1408N246O253S6
• Endotoxin: <0.001 EU per 1 μg by the LAL method
• Application: The product is a drug used for the treatment of relapsing/remitting multiple sclerosis. It has been shown to slow the advance of the disease as well as to decrease the frequency of attacks.
• Concentration: 250 μg/ml

Pharmaceutical Information

• Pharmaceutical Application: Interferon beta-1b
• Targets: Target 1. Interferon alpha/beta receptor 1; Target 2. Interferon alpha/beta receptor 2