Interferon beta-1b

Specification Drug Information Related Products

Cat#:	THP-0103
Product Name:	Interferon beta-1b
Description:	Human interferon beta (165 residues), cysteine 17 is substituted with serine. Produced in E. coli, no carbohydrates, MW=18.5kD
Sequences:	SYNLLGFLQRSSNFQSQKLLWQLNGRLEYCLKDRMNFDIPEEIKQLQQFQKEDAALTIYEMLQNIFAIFRQDSSSTGWNETIVENLLANVYHQINHLKTVLEEKLEKEDFTRGKLMSSLHLKRYYGRILHYLKAKEYSHCAWTIVRVEILRNFYFINRLTGYLRN
Species:	Human
Molecular Weight:	20011.0 Da
Source:	E. coli
Purity:	>99% by SDS-Page and HPLC analysis
Cas No:	145155-23-3
Formula:	C908H1408N246O253S6
Endotoxin Level:	<0.001 EU per 1 μg by the LAL method
Biological Activity:	250 μg/ml

Drug Name:	Interferon beta-1b
Applications:	The product is a drug used for the treatment of relapsing/remitting multiple sclerosis. It has been shown to slow the advance of the disease as well as to decrease the frequency of attacks.
Examples of Clinical Use:	Relapsing/remitting multiple sclerosis
Pharmacodynamics:	The product upregulates the expression of MHC I proteins, allowing for increased presentation of peptides derived from viral antigens. This enhances the activation of CD8+ T cells that are the precursors for cytotoxic T lymphocytes (CTLs) and makes the macrophage a better target for CTL-mediated killing. Type I interferons also induce the synthesis of several key antiviral mediators including 2'-5' oligoadenylate synthetase (2'-5' A synthetase), beta-2 microglobulin, neopterin and protein kinase R.
Mechanism of action:	Interferon beta binds to type I interferon receptors (IFNAR1 and IFNAR2c) which activate two Jak (Janus kinase) tyrosine kinases (Jak1 and Tyk2). These transphosphorylate themselves and phosphorylate the receptors. The phosphorylated INFAR receptors then bind to Stat1 and Stat2 (signal transducers and activators of transcription)which dimerize and activate multiple (~100) immunomodulatory and antiviral proteins. Interferon beta binds more stably to type I interferon receptors than interferon alpha.
Affected organisms:	Humans and other mammals
Targets:	Target 1. Interferon alpha/beta receptor 1; Target 2. Interferon alpha/beta receptor 2