0
Inquiry Basket
Quote

Interferon alfacon-1

Cat# : THP-0080

Product Datasheets COA :
Catalog# Product Name Availability Size Price Qty
THP-0080 Interferon alfacon-1 April 16, 2025 100ug $698.00
500ug $2,698.00
1mg $3,998.00
Add to Cart Online Order Request a Bulk Order
Cat#:  THP-0080
Product Name:  Interferon alfacon-1
Cas No:  118390-30-0
Description:  The product is a recombinant non-naturally occurring type-I interferon. The 166-amino acid sequence of The product was derived by scanning the sequences of several natural interferon alpha subtypes and assigning the most frequently observed amino acid in each corresponding position. Four additional amino acid changes were made to facilitate the molecular construction, and a corresponding synthetic DNA sequence was constructed using chemical synthesis methodology. The product differs from interferon alfa-2b at 20/166 amino acids (88% homology), and comparison with interferon-beta shows identity at over 30% of the amino acid positions. The product is produced in Escherichia coli (E. coli) cells that have been genetically altered by insertion of a synthetically constructed sequence that codes for the product. Prior to final purification, the product is allowed to oxidize to its native state, and its final purity is achieved by sequential passage over a series of chromatography columns. This protein has a molecular weight of 19,434 daltons.
Sequences:  MCDLPQTHSLGNRRALILLAQMRRISPFSCLKDRHDFGFPQEEFDGNQFQKAQAISVLHEMIQQTFNLFSTKDSSAAWDESLLEKFYTELYQQLNDLEACVIQEVGVEETPLMNVDSILAVKKYFQRITLYLTEKKYSPCAWEVVRAEIMRSFSLSTNLQERLRRKE
Species:  Human
Molecular Weight:  19343.0 Da
Source:  E. coli
Purity:  >99% by SDS-Page and HPLC analysis
Formula:  C860H1353N227O255S9
Endotoxin:  <0.001 EU per 1 μg by the LAL method
Application:  For the treatment of hairy cell leukemia, malignant melanoma, and AIDS-related Kaposi's sarcoma.
Concentration:  0.03 mg/ml
Not For Human Consumption!

Online Inquiry

  • Size: 100ug 500ug 1mg 5mg 10mg 100mg 500mg 1g
  • Conjugation: None R-PE APC Biotin FITC Alexa Flour Others
CONTACT US

For more information on how our products could help advance your project, please contact us.

Contact Us

ENTER YOUR EMAIL HERE TO SUBSCRIBE.

Copyright © 2025 Creative BioMart. All Rights Reserved.