Cat# : THP-0080
Catalog# | Product Name | Availability | Size | Price | Qty |
---|---|---|---|---|---|
THP-0080 | Interferon alfacon-1 | July 27, 2024 | 1 vial | $3,998.00 |
|
Add to Cart Online Order Request a Bulk Order |
Cat#: | THP-0080 |
Product Name: | Interferon alfacon-1 |
Description: | The product is a recombinant non-naturally occurring type-I interferon. The 166-amino acid sequence of The product was derived by scanning the sequences of several natural interferon alpha subtypes and assigning the most frequently observed amino acid in each corresponding position. Four additional amino acid changes were made to facilitate the molecular construction, and a corresponding synthetic DNA sequence was constructed using chemical synthesis methodology. The product differs from interferon alfa-2b at 20/166 amino acids (88% homology), and comparison with interferon-beta shows identity at over 30% of the amino acid positions. The product is produced in Escherichia coli (E. coli) cells that have been genetically altered by insertion of a synthetically constructed sequence that codes for the product. Prior to final purification, the product is allowed to oxidize to its native state, and its final purity is achieved by sequential passage over a series of chromatography columns. This protein has a molecular weight of 19,434 daltons. |
Sequences: | MCDLPQTHSLGNRRALILLAQMRRISPFSCLKDRHDFGFPQEEFDGNQFQKAQAISVLHEMIQQTFNLFSTKDSSAAWDESLLEKFYTELYQQLNDLEACVIQEVGVEETPLMNVDSILAVKKYFQRITLYLTEKKYSPCAWEVVRAEIMRSFSLSTNLQERLRRKE |
Species: | Human |
Molecular Weight: | 19343.0 Da |
Source: | E. coli |
Purity: | >99% by SDS-Page and HPLC analysis |
Cas No: | 118390-30-0 |
Formula: | C860H1353N227O255S9 |
Endotoxin Level: | <0.001 EU per 1 μg by the LAL method |
Biological Activity: | 0.03 mg/1mL |
For more information on how our products could help advance your project, please contact us.
ENTER YOUR EMAIL HERE TO SUBSCRIBE.
Copyright © 2024 Creative BioMart. All Rights Reserved.