Insulin Lispro(Recombinant)

Specification

• Cat#: THP-0130
• Product Name: Insulin Lispro(Recombinant)
• Cas No: 133107-64-9
• Description: The product is a recombinant human insulin analogue expressed in a E.coli. Plasmid DNA transfected into the bacteria encodes for an analogue of human insulin that has a lysine at residuce B28 and proline at B29; these residues are reversed in endogenous human insulin. Reversal of these amino acid residues produces a rapid-acting insulin analogue.
• Sequences: GIVEQCCTSICSLYQLENYCNFVNQHLCGSHLVEALYLVCGERGFFYTKPT
• Species: Human
• Molecular Weight: 5808.0 Da
• Source: E. coli
• Purity: >99% by SDS-Page and HPLC analysis
• Formula: C257H387N65O76S6
• Endotoxin: <0.001 EU per 1 μg of the protein by the LAL method
• Biological Activity: 100IU/ml
• Application: For the treatment of Type 1 or 2 diabetes mellitus. To be used in conjunction with an intermediate or long-acting insulin except when used in a continuous insulin infusion pump.

Pharmaceutical Information

• Pharmaceutical Application: Insulin Lispro
• Targets: Target 1. Insulin receptor; Target 2. Insulin-like growth factor 1 receptor; Enzyme 1. Cytochrome P450 1A2.