Cat# : THP-0130
| Catalog# | Product Name | Availability | Size | Price | Qty |
|---|---|---|---|---|---|
| THP-0130 | Insulin Lispro(Recombinant) | June 12, 2026 | 1 vial | $3,998.00 |
|
| Add to Cart Online Order Request a Bulk Order |
| Cat#: | THP-0130 |
| Product Name: | Insulin Lispro(Recombinant) |
| Cas No: | 133107-64-9 |
| Description: | The product is a recombinant human insulin analogue expressed in a E.coli. Plasmid DNA transfected into the bacteria encodes for an analogue of human insulin that has a lysine at residuce B28 and proline at B29; these residues are reversed in endogenous human insulin. Reversal of these amino acid residues produces a rapid-acting insulin analogue. |
| Sequences: | GIVEQCCTSICSLYQLENYCNFVNQHLCGSHLVEALYLVCGERGFFYTKPT |
| Species: | Human |
| Molecular Weight: | 5808.0 Da |
| Source: | E. coli |
| Purity: | >99% by SDS-Page and HPLC analysis |
| Formula: | C257H387N65O76S6 |
| Endotoxin: | <0.001 EU per 1 μg of the protein by the LAL method |
| Biological Activity: | 100IU/ml |
| Application: | For the treatment of Type 1 or 2 diabetes mellitus. To be used in conjunction with an intermediate or long-acting insulin except when used in a continuous insulin infusion pump. |
For more information on how our products could help advance your project, please contact us.
ENTER YOUR EMAIL HERE TO SUBSCRIBE.
Copyright © 2026 Creative BioMart. All Rights Reserved.