0
Inquiry Basket
Check Out

Insulin Lispro(Recombinant)

Cat# : THP-0130

Product Datasheets COA :
Catalog# Product Name Availability Size Price Qty
THP-0130 Insulin Lispro(Recombinant) September 28, 2023 1 vial $3,998.00
Add to Cart Online Order Request a Bulk Order
Cat#:  THP-0130
Product Name:  Insulin Lispro(Recombinant)
Description:  The product is a recombinant human insulin analogue expressed in a E.coli. Plasmid DNA transfected into the bacteria encodes for an analogue of human insulin that has a lysine at residuce B28 and proline at B29; these residues are reversed in endogenous human insulin. Reversal of these amino acid residues produces a rapid-acting insulin analogue.
Sequences:  GIVEQCCTSICSLYQLENYCNFVNQHLCGSHLVEALYLVCGERGFFYTKPT
Species:  Human
Molecular Weight:  5808.0 Da
Source:  E. coli
Purity:  >99% by SDS-Page and HPLC analysis
Cas No:  133107-64-9
Formula:  C257H387N65O76S6
Endotoxin Level:  <0.001 EU per 1 μg of the protein by the LAL method
Biological Activity:  100IU/ml
For research use only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.

Online Inquiry

  • Size: 100ug 500ug 1mg 5mg 10mg 100mg 500mg 1g
  • Conjugation: None R-PE APC Biotin FITC Alexa Flour Others
CONTACT US

For more information on how our products could help advance your project, please contact us.

Contact Us

ENTER YOUR EMAIL HERE TO SUBSCRIBE.

Copyright © 2023 Creative BioMart. All Rights Reserved.