0
Inquiry Basket
Quote

Insulin Human(Recombinant)

Cat# : THP-0129

Product Datasheets COA :
Catalog# Product Name Availability Size Price Qty
THP-0129 Insulin Human(Recombinant) April 14, 2024 1 vial $2,998.00
Add to Cart Online Order Request a Bulk Order
Cat#:  THP-0129
Product Name:  Insulin Human(Recombinant)
Description:  The product is a recombinant 51 residue peptide hormone, composed of two amino acid chains covalently linked by disulfide bonds. The structure is identical to native human insulin, inserting the human insulin gene into the E.coli bacteria or Saccharomyces cerevisiae.
Sequences:  GIVEQCCTSICSLYQLENYCNFVNQHLCGSHLVEALYLVCGERGFFYTPKT
Species:  Human
Molecular Weight:  5808.0 Da
Purity:  >99% by SDS-Page and HPLC analysis
Cas No:  11061-68-0
Formula:  C257H383N65O77S6
Endotoxin Level:  <0.001 EU per 1 μg of the protein by the LAL method
Biological Activity:  100IU/ml
For research use only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.

Online Inquiry

  • Size: 100ug 500ug 1mg 5mg 10mg 100mg 500mg 1g
  • Conjugation: None R-PE APC Biotin FITC Alexa Flour Others
CONTACT US

For more information on how our products could help advance your project, please contact us.

Contact Us

ENTER YOUR EMAIL HERE TO SUBSCRIBE.

Copyright © 2024 Creative BioMart. All Rights Reserved.