Cat# : THP-0129
Catalog# | Product Name | Availability | Size | Price | Qty |
---|---|---|---|---|---|
THP-0129 | Insulin Human(Recombinant) | October 10, 2025 | 1 vial | $2,998.00 |
|
Add to Cart Online Order Request a Bulk Order |
Cat#: | THP-0129 |
Product Name: | Insulin Human(Recombinant) |
Cas No: | 11061-68-0 |
Description: | The product is a recombinant 51 residue peptide hormone, composed of two amino acid chains covalently linked by disulfide bonds. The structure is identical to native human insulin, inserting the human insulin gene into the E.coli bacteria or Saccharomyces cerevisiae. |
Sequences: | GIVEQCCTSICSLYQLENYCNFVNQHLCGSHLVEALYLVCGERGFFYTPKT |
Species: | Human |
Molecular Weight: | 5808.0 Da |
Purity: | >99% by SDS-Page and HPLC analysis |
Formula: | C257H383N65O77S6 |
Endotoxin: | <0.001 EU per 1 μg of the protein by the LAL method |
Biological Activity: | 100IU/ml |
Application: | Indicated as an adjunct to diet and exercise to improve glycemic control in adults and children with type 1 and type 2 diabetes mellitus. |
For more information on how our products could help advance your project, please contact us.
ENTER YOUR EMAIL HERE TO SUBSCRIBE.
Copyright © 2025 Creative BioMart. All Rights Reserved.