Insulin Human(Recombinant)

Specification

• Cat#: THP-0129
• Product Name: Insulin Human(Recombinant)
• Cas No: 11061-68-0
• Description: The product is a recombinant 51 residue peptide hormone, composed of two amino acid chains covalently linked by disulfide bonds. The structure is identical to native human insulin, inserting the human insulin gene into the E.coli bacteria or Saccharomyces cerevisiae.
• Sequences: GIVEQCCTSICSLYQLENYCNFVNQHLCGSHLVEALYLVCGERGFFYTPKT
• Species: Human
• Molecular Weight: 5808.0 Da
• Purity: >99% by SDS-Page and HPLC analysis
• Formula: C257H383N65O77S6
• Endotoxin: <0.001 EU per 1 μg of the protein by the LAL method
• Biological Activity: 100IU/ml
• Application: Indicated as an adjunct to diet and exercise to improve glycemic control in adults and children with type 1 and type 2 diabetes mellitus.

Pharmaceutical Information

• Pharmaceutical Application: Insulin Human
• Targets: Target 1. Insulin receptor; Target 2. Insulin-like growth factor 1 receptor; Target 3. Retinoblastoma-associated protein; Target 4. Cathepsin D; Target 5. Insulin-degrading enzyme; Target 6. Neuroendocrine convertase 2; Target 7. Carboxypeptidase E; Target 8. Neuroendocrine convertase 1; Target 9. Protein NOV homolog; Target 10. Low-density lipoprotein receptor-related protein 2; Target 11. Insulin-like growth factor-binding protein 7; Target 12. Synaptotagmin-like protein 4; Enzyme 1. Cytochrome P450 1A2