0
Inquiry Basket
Quote

Insulin Glulisine(Recombinant)

Cat# : THP-0128

Product Datasheets COA :
Catalog# Product Name Availability Size Price Qty
THP-0128 Insulin Glulisine(Recombinant) March 01, 2024 1 vial $3,998.00
Add to Car Online Order Request a Bulk Order
Cat#:  THP-0128
Product Name:  Insulin Glulisine(Recombinant)
Description:  The product is a biosynthetic, rapid-acting human insulin analogue produced in a non-pathogenic laboratory strain of E.coli (K12). This recombinant hormone differs from native human insulin in that the amino acid arginine at position B3 is replaced by lysine and the lysine at position B29 is replaced by glutamic acid. These structural modifications decrease hexamer formation, stabilize the product monomers and increase the rate of absorption and onset of action compared to human insulin.
Sequences:  GIVEQCCTSICSLYQLENYCNFVKQHLCGSHLVEALYLVCGERGFFYTPET
Species:  Human
Molecular Weight:  5823.0 Da
Source:  E.coli (K12)
Purity:  >99% by SDS-Page and HPLC analysis
Cas No:  207748-29-6
Formula:  C258H384N64O78S6
Endotoxin Level:  <0.001 EU per 1 μg of the protein by the LAL method
Biological Activity:  100IU/ml
For research use only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
CONTACT US

For more information on how our products could help advance your project, please contact us.

Contact Us

ENTER YOUR EMAIL HERE TO SUBSCRIBE.

Copyright © 2024 Creative BioMart. All Rights Reserved.