0
Inquiry Basket
Quote

Insulin Glulisine(Recombinant)

Cat# : THP-0128

Product Datasheets COA :
Catalog# Product Name Availability Size Price Qty
THP-0128 Insulin Glulisine(Recombinant) August 27, 2025 1 vial $3,998.00
Add to Cart Online Order Request a Bulk Order
Cat#:  THP-0128
Product Name:  Insulin Glulisine(Recombinant)
Cas No:  207748-29-6
Description:  The product is a biosynthetic, rapid-acting human insulin analogue produced in a non-pathogenic laboratory strain of E.coli (K12). This recombinant hormone differs from native human insulin in that the amino acid arginine at position B3 is replaced by lysine and the lysine at position B29 is replaced by glutamic acid. These structural modifications decrease hexamer formation, stabilize the product monomers and increase the rate of absorption and onset of action compared to human insulin.
Sequences:  GIVEQCCTSICSLYQLENYCNFVKQHLCGSHLVEALYLVCGERGFFYTPET
Species:  Human
Molecular Weight:  5823.0 Da
Source:  E.coli (K12)
Purity:  >99% by SDS-Page and HPLC analysis
Formula:  C258H384N64O78S6
Endotoxin:  <0.001 EU per 1 μg of the protein by the LAL method
Biological Activity:  100IU/ml
Application:  For the treatment of Type 1 and 2 diabetes mellitus. Should be used in regimens including a long-acting or basal insulin analogue unless it is used in a continuous infusion pump. May be used with oral antidiabetic agents.
Not For Human Consumption!

Online Inquiry

  • Size: 100ug 500ug 1mg 5mg 10mg 100mg 500mg 1g
  • Conjugation: None R-PE APC Biotin FITC Alexa Flour Others
CONTACT US

For more information on how our products could help advance your project, please contact us.

Contact Us

ENTER YOUR EMAIL HERE TO SUBSCRIBE.

Copyright © 2025 Creative BioMart. All Rights Reserved.