Insulin Glulisine(Recombinant)

Specification

• Cat#: THP-0128
• Product Name: Insulin Glulisine(Recombinant)
• Cas No: 207748-29-6
• Description: The product is a biosynthetic, rapid-acting human insulin analogue produced in a non-pathogenic laboratory strain of E.coli (K12). This recombinant hormone differs from native human insulin in that the amino acid arginine at position B3 is replaced by lysine and the lysine at position B29 is replaced by glutamic acid. These structural modifications decrease hexamer formation, stabilize the product monomers and increase the rate of absorption and onset of action compared to human insulin.
• Sequences: GIVEQCCTSICSLYQLENYCNFVKQHLCGSHLVEALYLVCGERGFFYTPET
• Species: Human
• Molecular Weight: 5823.0 Da
• Source: E.coli (K12)
• Purity: >99% by SDS-Page and HPLC analysis
• Formula: C258H384N64O78S6
• Endotoxin: <0.001 EU per 1 μg of the protein by the LAL method
• Biological Activity: 100IU/ml
• Application: For the treatment of Type 1 and 2 diabetes mellitus. Should be used in regimens including a long-acting or basal insulin analogue unless it is used in a continuous infusion pump. May be used with oral antidiabetic agents.

Pharmaceutical Information

• Pharmaceutical Application: Insulin Glulisine
• Targets: Target 1. Insulin receptor; Enzyme 1. Cytochrome P450 1A2.