Cat# : THP-0128
Catalog# | Product Name | Availability | Size | Price | Qty |
---|---|---|---|---|---|
THP-0128 | Insulin Glulisine(Recombinant) | July 27, 2024 | 1 vial | $3,998.00 |
|
Add to Cart Online Order Request a Bulk Order |
Cat#: | THP-0128 |
Product Name: | Insulin Glulisine(Recombinant) |
Description: | The product is a biosynthetic, rapid-acting human insulin analogue produced in a non-pathogenic laboratory strain of E.coli (K12). This recombinant hormone differs from native human insulin in that the amino acid arginine at position B3 is replaced by lysine and the lysine at position B29 is replaced by glutamic acid. These structural modifications decrease hexamer formation, stabilize the product monomers and increase the rate of absorption and onset of action compared to human insulin. |
Sequences: | GIVEQCCTSICSLYQLENYCNFVKQHLCGSHLVEALYLVCGERGFFYTPET |
Species: | Human |
Molecular Weight: | 5823.0 Da |
Source: | E.coli (K12) |
Purity: | >99% by SDS-Page and HPLC analysis |
Cas No: | 207748-29-6 |
Formula: | C258H384N64O78S6 |
Endotoxin Level: | <0.001 EU per 1 μg of the protein by the LAL method |
Biological Activity: | 100IU/ml |
For more information on how our products could help advance your project, please contact us.
ENTER YOUR EMAIL HERE TO SUBSCRIBE.
Copyright © 2024 Creative BioMart. All Rights Reserved.