Insulin Glargine(Recombinant)

Specification

• Cat#: THP-0127
• Product Name: Insulin Glargine(Recombinant)
• Cas No: 160337-95-1
• Description: The insulin product is recombinantly expressed in a non-pathogenic laboratory strain of E.coli (K12) as the production organism. It is an analogue of human insulin made by replacing the asparagine residue at position A21 of the A-chain with glycine and adding two arginines to the C-terminus (positions B31 and 32) of the B-chain. The resulting protein is soluble at pH 4 and forms microprecipitates at physiological pH 7.4.
• Sequences: GIVEQCCTSICSLYQLENYCGFVNQHLCGSHLVEALYLVCGERGFFYTPKTRR
• Species: Human
• Molecular Weight: 6063.0 Da
• Source: E.coli (K12)
• Purity: >99% by SDS-Page and HPLC analysis
• Formula: C267H404N72O78S6
• Endotoxin: <0.001 EU per 1 μg of the protein by the LAL method
• Biological Activity: 100U/ml
• Application: For the treatment of Type 1 or 2 diabetes mellitus in patients over 17 years old who require a long-acting (basal) insulin for the control of hyperglycemia. May be used in pediatric patients with Type 1 diabetes mellitus who require a long-acting (basal) insulin for glycemic control.

Pharmaceutical Information

• Pharmaceutical Application: Insulin Glargine
• Targets: Target 1. Insulin receptor; Target 2. Insulin-like growth factor 1 receptor; Enzyme 1. Cytochrome P450 1A2.