Cat# : THP-0127
Catalog# | Product Name | Availability | Size | Price | Qty |
---|---|---|---|---|---|
THP-0127 | Insulin Glargine(Recombinant) | April 27, 2024 | 1 vial | $3,998.00 |
|
Add to Cart Online Order Request a Bulk Order |
Cat#: | THP-0127 |
Product Name: | Insulin Glargine(Recombinant) |
Description: | The insulin product is recombinantly expressed in a non-pathogenic laboratory strain of E.coli (K12) as the production organism. It is an analogue of human insulin made by replacing the asparagine residue at position A21 of the A-chain with glycine and adding two arginines to the C-terminus (positions B31 and 32) of the B-chain. The resulting protein is soluble at pH 4 and forms microprecipitates at physiological pH 7.4. |
Sequences: | GIVEQCCTSICSLYQLENYCGFVNQHLCGSHLVEALYLVCGERGFFYTPKTRR |
Species: | Human |
Molecular Weight: | 6063.0 Da |
Source: | E.coli (K12) |
Purity: | >99% by SDS-Page and HPLC analysis |
Cas No: | 160337-95-1 |
Formula: | C267H404N72O78S6 |
Endotoxin Level: | <0.001 EU per 1 μg of the protein by the LAL method |
Biological Activity: | 100U/ml |
For more information on how our products could help advance your project, please contact us.
ENTER YOUR EMAIL HERE TO SUBSCRIBE.
Copyright © 2024 Creative BioMart. All Rights Reserved.