0
Inquiry Basket
Check Out

Insulin Glargine(Recombinant)

Cat# : THP-0127

Product Datasheets COA :
Catalog# Product Name Availability Size Price Qty
THP-0127 Insulin Glargine(Recombinant) September 28, 2023 1 vial $3,998.00
Add to Cart Online Order Request a Bulk Order
Cat#:  THP-0127
Product Name:  Insulin Glargine(Recombinant)
Description:  The insulin product is recombinantly expressed in a non-pathogenic laboratory strain of E.coli (K12) as the production organism. It is an analogue of human insulin made by replacing the asparagine residue at position A21 of the A-chain with glycine and adding two arginines to the C-terminus (positions B31 and 32) of the B-chain. The resulting protein is soluble at pH 4 and forms microprecipitates at physiological pH 7.4.
Sequences:  GIVEQCCTSICSLYQLENYCGFVNQHLCGSHLVEALYLVCGERGFFYTPKTRR
Species:  Human
Molecular Weight:  6063.0 Da
Source:  E.coli (K12)
Purity:  >99% by SDS-Page and HPLC analysis
Cas No:  160337-95-1
Formula:  C267H404N72O78S6
Endotoxin Level:  <0.001 EU per 1 μg of the protein by the LAL method
Biological Activity:  100U/ml
For research use only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.

Online Inquiry

  • Size: 100ug 500ug 1mg 5mg 10mg 100mg 500mg 1g
  • Conjugation: None R-PE APC Biotin FITC Alexa Flour Others
CONTACT US

For more information on how our products could help advance your project, please contact us.

Contact Us

ENTER YOUR EMAIL HERE TO SUBSCRIBE.

Copyright © 2023 Creative BioMart. All Rights Reserved.