0
Inquiry Basket
Quote

Insulin Glargine(Recombinant)

Cat# : THP-0127

Product Datasheets COA :
Catalog# Product Name Availability Size Price Qty
THP-0127 Insulin Glargine(Recombinant) February 09, 2026 5 mg $498.00
10 mg $698.00
100 mg $3,998.00
Add to Cart Online Order Request a Bulk Order
Cat#:  THP-0127
Product Name:  Insulin Glargine(Recombinant)
Cas No:  160337-95-1
Description:  The insulin product is recombinantly expressed in a non-pathogenic laboratory strain of E.coli (K12) as the production organism. It is an analogue of human insulin made by replacing the asparagine residue at position A21 of the A-chain with glycine and adding two arginines to the C-terminus (positions B31 and 32) of the B-chain. The resulting protein is soluble at pH 4 and forms microprecipitates at physiological pH 7.4.
Sequences:  GIVEQCCTSICSLYQLENYCGFVNQHLCGSHLVEALYLVCGERGFFYTPKTRR
Species:  Human
Molecular Weight:  6063.0 Da
Source:  E.coli (K12)
Purity:  >99% by SDS-Page and HPLC analysis
Formula:  C267H404N72O78S6
Endotoxin:  <0.001 EU per 1 μg of the protein by the LAL method
Biological Activity:  100U/ml
Application:  For the treatment of Type 1 or 2 diabetes mellitus in patients over 17 years old who require a long-acting (basal) insulin for the control of hyperglycemia. May be used in pediatric patients with Type 1 diabetes mellitus who require a long-acting (basal) insulin for glycemic control.
Not For Human Consumption!

Online Inquiry

  • Size: 100ug 500ug 1mg 5mg 10mg 100mg 500mg 1g
  • Conjugation: None R-PE APC Biotin FITC Alexa Flour Others
CONTACT US

For more information on how our products could help advance your project, please contact us.

Contact Us

ENTER YOUR EMAIL HERE TO SUBSCRIBE.

Copyright © 2026 Creative BioMart. All Rights Reserved.