0
Inquiry Basket
Quote

Glial Growth Factor (GGF2)

Cat# : THP-0237

Product Datasheets COA :
Catalog# Product Name Availability Size Price Qty
THP-0237 Glial Growth Factor (GGF2) July 27, 2024 1 vial $3,998.00
Add to Cart Online Order Request a Bulk Order
Cat#:  THP-0237
Product Name:  Glial Growth Factor (GGF2)
Description:  Recombinant human GGF2 (Glial growth factor) is a disulfide-linked monomeric protein consisting of 315 amino acid residues, and migrates as an approximately 34 kDa protein under non-reducing and reducing conditions in SDS-PAGE. Optimized DNA sequence encoding Human Neuregulin-1 isoform 9 (GGF2) was expressed in E. coli.
Sequences:  GNEAAPAGASVCYSSPPSVGSVQELAQRAAVVIEGKVHPQRRQQGALDRKAAAAAGEAGAWGGDREPPAAGPRALGPPAEEPLLAANGTVPSWPTAPVPSAGEPGEEAPYLVKVHQVWAVKAGGLKKDSLLTVRLGTWGHPAFPSCGRLKEDSRYIFFMEPDANSTSRAPAAFRASFPPLETGRNLKKEVSRVLCKRCALPPRLKEMKSQESAAGSKLVLRCETSSEYSSLRFKWFKNGNELNRKNKPQNIKIQKKPGKSELRINKASLADSGEYMCKVISKLGNDSASANITIVESNATSTSTTGTSHLVKCAE
Species:  Human
Molecular Weight:  34 kDa
Source:  E. Coli
Introduction:  Neuregulins (NDF, heregulin, GGF, ARIA, or SMDF) are EGF-like growth and differentiation factors that signal through tyrosine kinase receptors of the ErbB family. The ErbB2 and ErbB4 receptors cooperate in transmission of neuregulin-1 signals in the heart, whereas ErbB2 and ErbB3 cooperate in neural crest cells. Glial growth factor 2 has been used in trials studying the treatment of Heart Failure.
Purity:  ≥95% by SDS-PAGE and HPLC
Formulation:  lyophilized protein. Lyophilized from a 0.2 µm filtered 10 mM phosphate buffer, pH 7.0.
Biological Activity:  The ED50 was determined by the dose-dependent phosphorylation of human MCF-7 cells was found to be <20 ng/ml, corresponding to a specific activity of 5 x 10^4 Units/mg.
Reconstitution:  Reconstitute at 0.1-1.0 mg/ml in distilled water. This solution can then be diluted into other buffers. To maximize product collection from vial surface, vortex briefly and then spin down to recollect the liquid.
For research use only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.

Online Inquiry

  • Size: 100ug 500ug 1mg 5mg 10mg 100mg 500mg 1g
  • Conjugation: None R-PE APC Biotin FITC Alexa Flour Others
CONTACT US

For more information on how our products could help advance your project, please contact us.

Contact Us

ENTER YOUR EMAIL HERE TO SUBSCRIBE.

Copyright © 2024 Creative BioMart. All Rights Reserved.