Glial Growth Factor (GGF2)

Specification

• Cat#: THP-0237
• Product Name: Glial Growth Factor (GGF2)
• Description: Recombinant human GGF2 (Glial growth factor) is a disulfide-linked monomeric protein consisting of 315 amino acid residues, and migrates as an approximately 34 kDa protein under non-reducing and reducing conditions in SDS-PAGE. Optimized DNA sequence encoding Human Neuregulin-1 isoform 9 (GGF2) was expressed in E. coli.
• Sequences: GNEAAPAGASVCYSSPPSVGSVQELAQRAAVVIEGKVHPQRRQQGALDRKAAAAAGEAGAWGGDREPPAAGPRALGPPAEEPLLAANGTVPSWPTAPVPSAGEPGEEAPYLVKVHQVWAVKAGGLKKDSLLTVRLGTWGHPAFPSCGRLKEDSRYIFFMEPDANSTSRAPAAFRASFPPLETGRNLKKEVSRVLCKRCALPPRLKEMKSQESAAGSKLVLRCETSSEYSSLRFKWFKNGNELNRKNKPQNIKIQKKPGKSELRINKASLADSGEYMCKVISKLGNDSASANITIVESNATSTSTTGTSHLVKCAE
• Species: Human
• Molecular Weight: 34 kDa
• Source: E. Coli
• Introduction: Neuregulins (NDF, heregulin, GGF, ARIA, or SMDF) are EGF-like growth and differentiation factors that signal through tyrosine kinase receptors of the ErbB family. The ErbB2 and ErbB4 receptors cooperate in transmission of neuregulin-1 signals in the heart, whereas ErbB2 and ErbB3 cooperate in neural crest cells. Glial growth factor 2 has been used in trials studying the treatment of Heart Failure.
• Purity: ≥95% by SDS-PAGE and HPLC
• Biological Activity: The ED50 was determined by the dose-dependent phosphorylation of human MCF-7 cells was found to be <20 ng/ml, corresponding to a specific activity of 5 x 10＾4 Units/mg.
• Reconstitution: Reconstitute at 0.1-1.0 mg/ml in distilled water. This solution can then be diluted into other buffers. To maximize product collection from vial surface, vortex briefly and then spin down to recollect the liquid.
• Application: Glial growth factor 2 has been used in trials studying the treatment of Heart Failure.