Cat# : THP-0237
Catalog# | Product Name | Availability | Size | Price | Qty |
---|---|---|---|---|---|
THP-0237 | Glial Growth Factor (GGF2) | July 03, 2025 | 1 vial | $3,998.00 |
|
Add to Cart Online Order Request a Bulk Order |
Cat#: | THP-0237 |
Product Name: | Glial Growth Factor (GGF2) |
Description: | Recombinant human GGF2 (Glial growth factor) is a disulfide-linked monomeric protein consisting of 315 amino acid residues, and migrates as an approximately 34 kDa protein under non-reducing and reducing conditions in SDS-PAGE. Optimized DNA sequence encoding Human Neuregulin-1 isoform 9 (GGF2) was expressed in E. coli. |
Sequences: | GNEAAPAGASVCYSSPPSVGSVQELAQRAAVVIEGKVHPQRRQQGALDRKAAAAAGEAGAWGGDREPPAAGPRALGPPAEEPLLAANGTVPSWPTAPVPSAGEPGEEAPYLVKVHQVWAVKAGGLKKDSLLTVRLGTWGHPAFPSCGRLKEDSRYIFFMEPDANSTSRAPAAFRASFPPLETGRNLKKEVSRVLCKRCALPPRLKEMKSQESAAGSKLVLRCETSSEYSSLRFKWFKNGNELNRKNKPQNIKIQKKPGKSELRINKASLADSGEYMCKVISKLGNDSASANITIVESNATSTSTTGTSHLVKCAE |
Species: | Human |
Molecular Weight: | 34 kDa |
Source: | E. Coli |
Introduction: | Neuregulins (NDF, heregulin, GGF, ARIA, or SMDF) are EGF-like growth and differentiation factors that signal through tyrosine kinase receptors of the ErbB family. The ErbB2 and ErbB4 receptors cooperate in transmission of neuregulin-1 signals in the heart, whereas ErbB2 and ErbB3 cooperate in neural crest cells. Glial growth factor 2 has been used in trials studying the treatment of Heart Failure. |
Purity: | ≥95% by SDS-PAGE and HPLC |
Biological Activity: | The ED50 was determined by the dose-dependent phosphorylation of human MCF-7 cells was found to be <20 ng/ml, corresponding to a specific activity of 5 x 10^4 Units/mg. |
Reconstitution: | Reconstitute at 0.1-1.0 mg/ml in distilled water. This solution can then be diluted into other buffers. To maximize product collection from vial surface, vortex briefly and then spin down to recollect the liquid. |
Application: | Glial growth factor 2 has been used in trials studying the treatment of Heart Failure. |
For more information on how our products could help advance your project, please contact us.
ENTER YOUR EMAIL HERE TO SUBSCRIBE.
Copyright © 2025 Creative BioMart. All Rights Reserved.