0
Inquiry Basket
Quote

Filgrastim, Recombinant human GCSF

Cat# : THP-0071

Product Datasheets COA :
Catalog# Product Name Availability Size Price Qty
THP-0071 Filgrastim, Recombinant human GCSF April 15, 2024 1 vial $3,998.00
Add to Cart Online Order Request a Bulk Order
Cat#:  THP-0071
Product Name:  Filgrastim, Recombinant human GCSF
Description:  The product is a recombinant, non-pegylated human granulocyte colony stimulating factor (G-CSF) analog.
Sequences:  MTPLGPASSLPQSFLLKCLEQVRKIQGDGAALQEKLCATYKLCHPEELVLLGHSLGIPWAPLSSCPSQALQLAGCLSQLHSGLFLYQGLLQALEGISPELGPTLDTLQLDVADFATTIWQQMEELGMAPALQPTQGAMPAFASAFQRRAGGVLVASHLQSFLEVSYRVLRHLAQP
Species:  Human
Molecular Weight:  18800.0 Da
Purity:  >99% by SDS-Page and HPLC analysis
Cas No:  121181-53-1
Formula:  C845H1343N223O243S9
Endotoxin Level:  <0.001 EU per 1 μg of the protein by the LAL method
Biological Activity:  48000000 U/0.5ml
For research use only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.

Online Inquiry

  • Size: 100ug 500ug 1mg 5mg 10mg 100mg 500mg 1g
  • Conjugation: None R-PE APC Biotin FITC Alexa Flour Others
CONTACT US

For more information on how our products could help advance your project, please contact us.

Contact Us

ENTER YOUR EMAIL HERE TO SUBSCRIBE.

Copyright © 2024 Creative BioMart. All Rights Reserved.