Filgrastim, Recombinant human GCSF

Specification

• Cat#: THP-0071
• Product Name: Filgrastim, Recombinant human GCSF
• Cas No: 121181-53-1
• Description: The product is a recombinant, non-pegylated human granulocyte colony stimulating factor (G-CSF) analog.
• Sequences: MTPLGPASSLPQSFLLKCLEQVRKIQGDGAALQEKLCATYKLCHPEELVLLGHSLGIPWAPLSSCPSQALQLAGCLSQLHSGLFLYQGLLQALEGISPELGPTLDTLQLDVADFATTIWQQMEELGMAPALQPTQGAMPAFASAFQRRAGGVLVASHLQSFLEVSYRVLRHLAQP
• Species: Human
• Molecular Weight: 18800.0 Da
• Purity: > 99% by SDS-Page and HPLC analysis
• Formula: C845H1343N223O243S9
• Endotoxin: <0.001 EU per 1 μg of the protein by the LAL method
• Biological Activity: 48000000 U/0.5ml
• Application: This drug is a leucocyte growth factor indicated to:Decrease the incidence of infection‚ as manifested by febrile neutropenia‚in patients with nonmyeloid malignancies receiving myelosuppressive anti-cancer drugs associated with a significant incidence of severe neutropenia with fever. Reduce the time to neutrophil recovery and the duration of fever, following induction or consolidation chemotherapy treatment in patients with acute myeloid leukemia (AML)Reduce the duration of neutropenia and neutropenia-related clinical sequelae‚ e.g.‚ febrile neutropenia, in patients with nonmyeloid malignancies undergoing myeloablative chemotherapy followed by bone marrow transplantation (BMT)Mobilize autologous hematopoietic progenitor cells into the peripheral blood for collection by leukapheresisReduce the incidence and duration of sequelae of severe neutropenia (e.g.‚ fever‚ infections‚ oropharyngeal ulcers) in symptomatic patients with congenital neutropenia‚ cyclic neutropenia‚ or idiopathic neutropenia.Neupogen is approved for treatment of patients with radiation-induced myelosuppression following a radiological/nuclear incident.

Pharmaceutical Information

• Pharmaceutical Application: Filgrastim
• Targets: Target 1. Granulocyte colony-stimulating factor receptor; Target 2. Neutrophil elastase