0
Inquiry Basket
Quote

Filgrastim, Recombinant human GCSF

Cat# : THP-0071

Product Datasheets COA :
Catalog# Product Name Availability Size Price Qty
THP-0071 Filgrastim, Recombinant human GCSF July 05, 2025 1 vial $3,998.00
Add to Cart Online Order Request a Bulk Order
Cat#:  THP-0071
Product Name:  Filgrastim, Recombinant human GCSF
Cas No:  121181-53-1
Description:  The product is a recombinant, non-pegylated human granulocyte colony stimulating factor (G-CSF) analog.
Sequences:  MTPLGPASSLPQSFLLKCLEQVRKIQGDGAALQEKLCATYKLCHPEELVLLGHSLGIPWAPLSSCPSQALQLAGCLSQLHSGLFLYQGLLQALEGISPELGPTLDTLQLDVADFATTIWQQMEELGMAPALQPTQGAMPAFASAFQRRAGGVLVASHLQSFLEVSYRVLRHLAQP
Species:  Human
Molecular Weight:  18800.0 Da
Purity:  > 99% by SDS-Page and HPLC analysis
Formula:  C845H1343N223O243S9
Endotoxin:  <0.001 EU per 1 μg of the protein by the LAL method
Biological Activity:  48000000 U/0.5ml
Application:  This drug is a leucocyte growth factor indicated to:Decrease the incidence of infection‚ as manifested by febrile neutropenia‚in patients with nonmyeloid malignancies receiving myelosuppressive anti-cancer drugs associated with a significant incidence of severe neutropenia with fever. Reduce the time to neutrophil recovery and the duration of fever, following induction or consolidation chemotherapy treatment in patients with acute myeloid leukemia (AML)Reduce the duration of neutropenia and neutropenia-related clinical sequelae‚ e.g.‚ febrile neutropenia, in patients with nonmyeloid malignancies undergoing myeloablative chemotherapy followed by bone marrow transplantation (BMT)Mobilize autologous hematopoietic progenitor cells into the peripheral blood for collection by leukapheresisReduce the incidence and duration of sequelae of severe neutropenia (e.g.‚ fever‚ infections‚ oropharyngeal ulcers) in symptomatic patients with congenital neutropenia‚ cyclic neutropenia‚ or idiopathic neutropenia.Neupogen is approved for treatment of patients with radiation-induced myelosuppression following a radiological/nuclear incident.
Not For Human Consumption!

Online Inquiry

  • Size: 100ug 500ug 1mg 5mg 10mg 100mg 500mg 1g
  • Conjugation: None R-PE APC Biotin FITC Alexa Flour Others
CONTACT US

For more information on how our products could help advance your project, please contact us.

Contact Us

ENTER YOUR EMAIL HERE TO SUBSCRIBE.

Copyright © 2025 Creative BioMart. All Rights Reserved.