Cat# : THP-0215
| Catalog# | Product Name | Availability | Size | Price | Qty |
|---|---|---|---|---|---|
| THP-0215 | Elapegademase, PEGylated recombinant adenosine deaminase | November 04, 2025 | 1 vial | $3,998.00 |
|
| Add to Cart Online Order Request a Bulk Order |
| Cat#: | THP-0215 |
| Product Name: | Elapegademase, PEGylated recombinant adenosine deaminase |
| Cas No: | 1709806-75-6 |
| Description: | The product is a PEGylated recombinant adenosine deaminase. It can be defined molecularly as a genetically modified bovine adenosine deaminase with a modification in cysteine 74 for serine and with about 13 methoxy polyethylene glycol chains bound via carbonyl group in alanine and lysine residues. |
| Sequences: | AQTPAFNKPKVELHVHLDGAIKPETILYYGRKRGIALPADTPEELQNIIGMDKPLSLPEFLAKFDYYMPAIAGSREAVKRIAYEFVEMKAKDGVVYVEVRYSPHLLANSKVEPIPWNQAEGDLTPDEVVSLVNQGLQEGERDFGVKVRSILCCMRHQPSWSSEVVELCKKYREQTVVAIDLAGDETIEGSSLFPGHVKAYAEAVKSGVHRTVHAGEVGSANVVKEAVDTLKTERLGHGYHTLEDTTLYNRLRQENMHFEVCPWSSYLTGAWKPDTEHPVVRFKNDQVNYSLNTDDPLIFKSTLDTDYQMTKNEMGFTEEEFKRLNINAAKSSFLPEDEKKELLDLLYKAYGMPSPA |
| Molecular Weight: | 115000.0 Da |
| Source: | E.coli |
| Purity: | >99% by SDS-Page and HPLC analysis |
| Formula: | C1797H2795N477O544S12 |
| Endotoxin: | <0.001 EU per 1 μg of the peptide by the LAL method |
| Application: | The product is approved for the treatment of adenosine deaminase severe combined immune deficiency (ADA-SCID) in pediatric and adult patients. This condition was previously treated by the use of pegamedase bovine as part of an enzyme replacement therapy. ADA-SCID is a genetically inherited disorder that is very rare and characterized by a deficiency in the adenosine deaminase enzyme. The patients suffering from this disease often present a compromised immune system. This condition is characterized by very low levels of white blood cells and immunoglobulin levels which results in severe and recurring infections. |
| Concentration: | 1.6mg/ml |
For more information on how our products could help advance your project, please contact us.
ENTER YOUR EMAIL HERE TO SUBSCRIBE.
Copyright © 2025 Creative BioMart. All Rights Reserved.