0
Inquiry Basket
Quote

Elapegademase, PEGylated recombinant adenosine deaminase

Cat# : THP-0215

Product Datasheets COA :
Catalog# Product Name Availability Size Price Qty
THP-0215 Elapegademase, PEGylated recombinant adenosine deaminase May 18, 2024 1 vial $3,998.00
Add to Cart Online Order Request a Bulk Order
Cat#:  THP-0215
Product Name:  Elapegademase, PEGylated recombinant adenosine deaminase
Description:  The product is a PEGylated recombinant adenosine deaminase. It can be defined molecularly as a genetically modified bovine adenosine deaminase with a modification in cysteine 74 for serine and with about 13 methoxy polyethylene glycol chains bound via carbonyl group in alanine and lysine residues.
Sequences:  AQTPAFNKPKVELHVHLDGAIKPETILYYGRKRGIALPADTPEELQNIIGMDKPLSLPEFLAKFDYYMPAIAGSREAVKRIAYEFVEMKAKDGVVYVEVRYSPHLLANSKVEPIPWNQAEGDLTPDEVVSLVNQGLQEGERDFGVKVRSILCCMRHQPSWSSEVVELCKKYREQTVVAIDLAGDETIEGSSLFPGHVKAYAEAVKSGVHRTVHAGEVGSANVVKEAVDTLKTERLGHGYHTLEDTTLYNRLRQENMHFEVCPWSSYLTGAWKPDTEHPVVRFKNDQVNYSLNTDDPLIFKSTLDTDYQMTKNEMGFTEEEFKRLNINAAKSSFLPEDEKKELLDLLYKAYGMPSPA
Molecular Weight:  115000.0 Da
Source:  E.coli
Purity:  >99% by SDS-Page and HPLC analysis
Cas No:  1709806-75-6
Formula:  C1797H2795N477O544S12
Endotoxin Level:  <0.001 EU per 1 μg of the peptide by the LAL method
Biological Activity:  1.6mg/ml
For research use only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.

Online Inquiry

  • Size: 100ug 500ug 1mg 5mg 10mg 100mg 500mg 1g
  • Conjugation: None R-PE APC Biotin FITC Alexa Flour Others
CONTACT US

For more information on how our products could help advance your project, please contact us.

Contact Us

ENTER YOUR EMAIL HERE TO SUBSCRIBE.

Copyright © 2024 Creative BioMart. All Rights Reserved.