0
Inquiry Basket
Quote

Elapegademase, PEGylated recombinant adenosine deaminase

Cat# : THP-0215

Product Datasheets COA :
Catalog# Product Name Availability Size Price Qty
THP-0215 Elapegademase, PEGylated recombinant adenosine deaminase May 16, 2025 1 vial $3,998.00
Add to Cart Online Order Request a Bulk Order
Cat#:  THP-0215
Product Name:  Elapegademase, PEGylated recombinant adenosine deaminase
Cas No:  1709806-75-6
Description:  The product is a PEGylated recombinant adenosine deaminase. It can be defined molecularly as a genetically modified bovine adenosine deaminase with a modification in cysteine 74 for serine and with about 13 methoxy polyethylene glycol chains bound via carbonyl group in alanine and lysine residues.
Sequences:  AQTPAFNKPKVELHVHLDGAIKPETILYYGRKRGIALPADTPEELQNIIGMDKPLSLPEFLAKFDYYMPAIAGSREAVKRIAYEFVEMKAKDGVVYVEVRYSPHLLANSKVEPIPWNQAEGDLTPDEVVSLVNQGLQEGERDFGVKVRSILCCMRHQPSWSSEVVELCKKYREQTVVAIDLAGDETIEGSSLFPGHVKAYAEAVKSGVHRTVHAGEVGSANVVKEAVDTLKTERLGHGYHTLEDTTLYNRLRQENMHFEVCPWSSYLTGAWKPDTEHPVVRFKNDQVNYSLNTDDPLIFKSTLDTDYQMTKNEMGFTEEEFKRLNINAAKSSFLPEDEKKELLDLLYKAYGMPSPA
Molecular Weight:  115000.0 Da
Source:  E.coli
Purity:  >99% by SDS-Page and HPLC analysis
Formula:  C1797H2795N477O544S12
Endotoxin:  <0.001 EU per 1 μg of the peptide by the LAL method
Application:  The product is approved for the treatment of adenosine deaminase severe combined immune deficiency (ADA-SCID) in pediatric and adult patients. This condition was previously treated by the use of pegamedase bovine as part of an enzyme replacement therapy. ADA-SCID is a genetically inherited disorder that is very rare and characterized by a deficiency in the adenosine deaminase enzyme. The patients suffering from this disease often present a compromised immune system. This condition is characterized by very low levels of white blood cells and immunoglobulin levels which results in severe and recurring infections.
Concentration:  1.6mg/ml
Not For Human Consumption!

Online Inquiry

  • Size: 100ug 500ug 1mg 5mg 10mg 100mg 500mg 1g
  • Conjugation: None R-PE APC Biotin FITC Alexa Flour Others
CONTACT US

For more information on how our products could help advance your project, please contact us.

Contact Us

ENTER YOUR EMAIL HERE TO SUBSCRIBE.

Copyright © 2025 Creative BioMart. All Rights Reserved.