0
Inquiry Basket
Quote

Drotrecogin alfa, Activated human protein C

Cat# : THP-0111

Product Datasheets COA :
Catalog# Product Name Availability Size Price Qty
THP-0111 Drotrecogin alfa, Activated human protein C March 01, 2024 50ug $3,998.00
Add to Car Online Order Request a Bulk Order
Cat#:  THP-0111
Product Name:  Drotrecogin alfa, Activated human protein C
Description:  The product is recombinant activated human protein C. It is a glycoprotein of approximately 55KDa, consisting of a heavy chain and a light chain linked by a disulfide bond.
Sequences:  LIDGKMTRRGDSPWQVVLLDSKKKLACGAVLIHPSWVLTAAHCMDESKKLLVRLGEYDLRRWEKWELDLDIKEVFVHPNYSKSTTDNDIALLHLAQPATLSQTIVPICLPDSGLAERELNQAGQETLVTGWGYHSSREKEAKRNRTFVLNFIKIPVVPHNECSEVMSNMVSENMLCAGILGDRQDACEGDSGGPMVASFHGTWFLVGLVSWGEGCGLLHNYGVYTKVSRYLDWIHGHIRDKEAPQKSWAPSKHVDGDQCLVLPLEHPCASLCCGHGTCIXGIGSFSCDCRSGWEGRFCQREVSFLNCSLDNGGCTHYCLEEVGWRRCSCAPGYKLGDDLLQCHPAVKFPCGRPWKRMEKKRSHL
Species:  Human
Molecular Weight:  55000.0 Da
Purity:  >99% by SDS-Page and HPLC analysis
Cas No:  98530-76-8
Formula:  C1786H2779N509O519S29
Endotoxin Level:  <0.001 EU per 1 μg of the peptide by the LAL method
Biological Activity:  2mg/ml
For research use only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
CONTACT US

For more information on how our products could help advance your project, please contact us.

Contact Us

ENTER YOUR EMAIL HERE TO SUBSCRIBE.

Copyright © 2024 Creative BioMart. All Rights Reserved.