Drotrecogin alfa, Activated human protein C

Specification

• Cat#: THP-0111
• Product Name: Drotrecogin alfa, Activated human protein C
• Cas No: 98530-76-8
• Description: The product is recombinant activated human protein C. It is a glycoprotein of approximately 55KDa, consisting of a heavy chain and a light chain linked by a disulfide bond.
• Sequences: LIDGKMTRRGDSPWQVVLLDSKKKLACGAVLIHPSWVLTAAHCMDESKKLLVRLGEYDLRRWEKWELDLDIKEVFVHPNYSKSTTDNDIALLHLAQPATLSQTIVPICLPDSGLAERELNQAGQETLVTGWGYHSSREKEAKRNRTFVLNFIKIPVVPHNECSEVMSNMVSENMLCAGILGDRQDACEGDSGGPMVASFHGTWFLVGLVSWGEGCGLLHNYGVYTKVSRYLDWIHGHIRDKEAPQKSWAPSKHVDGDQCLVLPLEHPCASLCCGHGTCIXGIGSFSCDCRSGWEGRFCQREVSFLNCSLDNGGCTHYCLEEVGWRRCSCAPGYKLGDDLLQCHPAVKFPCGRPWKRMEKKRSHL
• Species: Human
• Molecular Weight: 55000.0 Da
• Purity: >99% by SDS-Page and HPLC analysis
• Formula: C1786H2779N509O519S29
• Endotoxin: <0.001 EU per 1 μg of the peptide by the LAL method
• Application: For reduction of mortality in patients with severe sepsis.
• Concentration: 2mg/ml

Pharmaceutical Information

• Pharmaceutical Application: Drotrecogin alfa
• Targets: Target 1. Coagulation factor VIII; Target 2. Coagulation factor V; Target 3. Plasminogen activator inhibitor 1; Target 4. Thrombomodulin; Target 5. Vitamin K-dependent protein S; Target 6. Ceruloplasmin; Target 7. Prothrombin; Target 8. Platelet factor 4; Target 9. Plasma serine protease inhibitor; Target 10. Serpin B6; Target 11. Vitamin K-dependent gamma-carboxylase; Target 12. Endothelial protein C receptor