Choriogonadotropin alfa, Recombinant human chorionic gonadotropin

Specification

• Cat#: THP-0139
• Product Name: Choriogonadotropin alfa, Recombinant human chorionic gonadotropin
• Description: Recombinant human chorionic gonadotropin (Choriogonadotropin alfa) with 2 subunits, alpha = 92 a.a., beta = 145 a.a., each with N-and O-linked carbohydrate moieties linked to ASN-52 and ASN-78 (on alpha subunit) and ASN-13, ASN-30, SER-121, SER-127, SER-132 and SER-138 (on beta subunit). The primary structure of the alpha-chain of r-hCG is identical to that of the alpha-chain of hCG, FSH and LH.
• Sequences: APDVQDCPECTLQENPFFSQPGAPILQCMGCCFSRAYPTPLRSKKTMLVQKNVTSESTCCVAKSYNRVTVMGGFKVENHTACHCSTCYYHKSSKEPLRPRCRPINATLAVEKEGCPVCITVNTTICAGYCPTMTRVLQGVLPALPQVVCNYRDVRFESIRLPGCPRGVNPVVSYAVALSCQCALCRRSTTDCGGPKDHPLTCDDPRFQDSSSSKAPPPSLPSPSRLPGPSDTPILPQ
• Species: Human
• Molecular Weight: 25719.7 Da
• Purity: >99% by SDS-Page and HPLC analysis
• Cas No: 177073-44-8
• Formula: C1105H1770N318O336S26
• Endotoxin Level: <0.001 EU per 1 μg by the LAL method
• Biological Activity: 10000U/10mL

Pharmaceutical Information

• Pharmaceutical Application: Choriogonadotropin alfa
• Applications: For the treatment of female infertility
• Examples of Clinical Use: Female infertility
• Pharmacodynamics: The product is used to treat female infertility, the product stimulates late follicular maturation and resumption of oocyte meiosis, and initiates rupture of the pre-ovulatory ovarian follicle. The product is an analogue of Luteinizing Hormone (LH) and binds to the LH/hCG receptor of the granulosa and theca cells of the ovary to effect these changes in the absence of an endogenous LH surge.
• Mechanism of action: Choriogonadotropin alfa binds to the Follicle stimulating hormone receptor which results in ovulation in the absence of sufficient endogenous Luteinizing hormone.
• Affected organisms: Humans and other mammals
• Targets: Target 1. Lutropin-choriogonadotropic hormone receptor; Target 2. Follicle-stimulating hormone receptor

Related Reading

1. Basic introduction

Choriogonadotropin alfa (Choriogonadotropin Alfa), commonly referred to as CG-α, is a synthetic artificial preparation, similar to the naturally occurring human chorionic gonadotropin (HCG), a protein synthesized in the laboratory through genetic recombination technology. Cg-α is mainly used in the field of gynecology and reproductive medicine and has a biological function similar to HCG, but is structurally different from HCG. It can simulate the physiological effects of HCG by activating the LH/CG receptor, and in gynecology and reproductive medicine, CG-α is often used to assist infertility treatment and promote the development of follicle maturation and ovulation.
Compared to HCG, CG-α is slightly different in structure, but its biological activity and clinical application are similar. Cg-α is a cell-free synthetic drug with higher purity and a more controlled production process that can better meet clinical needs. It is important to note that CG-alpha as a drug must be used under the guidance of a medical professional to ensure safety and effectiveness. It is used in the field of gynecology and reproductive medicine in appropriate clinical situations to help promote the normal course of ovarian function and pregnancy development.

2. Clinical and medical use

Choriogonadotropin alfa has the following main clinical uses:
(1) Ovulation stimulating treatment: Choriogonadotropin alfa is often used as an adjunct to infertility treatment, to promote the growth and maturation of follicles, and to induce ovulation. It can be used in combination with other ovulation-stimulating drugs (such as artificial gonadotropin) to improve the quality and quantity of eggs and increase the chance of conception.
(2) In vitro fertilization (IVF) treatment: During IVF, Choriogonadotropin alfa is usually used to trigger the final maturation and release of follicles, and it is injected before egg collection to ensure timely ovulation so that eggs can be collected at the right point in time.
(3) Pregnancy monitoring: In some gynecological and reproductive medicine procedures, Choriogonadotropin alfa can also be used for pregnancy monitoring. After the injection of Choriogonadotropin alfa, a successful pregnancy can be determined by monitoring HCG levels in serum or urine.
To sum up, Choriogonadotropin alfa is mainly used in gynecological and reproductive medicine fields such as ovulation induction treatment, IVF treatment, and pregnancy monitoring. It helps regulate ovarian function and promotes the occurrence of pregnancy by mimicking the biological function of the body's naturally produced chorionic gonadotropin. It is important to note that it is a powerful hormonal drug and may cause side effects such as ovarian hyperstimulation syndrome (OHSS), so it needs to be closely monitored and follow your doctor's recommendations when using it.

3. Action pathway

The action pathway of Choriogonadotropin alfa mainly involves the following aspects:
(1) LH/CG receptor activation: Choriogonadotropin alfa activates these receptors by binding to LH/CG receptors on the surface of ovarian and testicular cells and mimics the action of LH (luteinizing hormone) or HCG. This activation process can promote the maturation and release of eggs or sperm.
(2) Promote follicular development and ovulation: One of the main functions of Choriogonadotropin alfa is to promote the development and maturation of ovarian follicles, and then induce ovulation of follicles. It can stimulate the follicle cells in the ovary to produce luteinizing hormone, to maintain the normal development and function of the lutein of the ovary.
(3) Induction of luteal formation and function: The role of Choriogonadotropin alfa also includes regulation of luteal formation and function after ovulation. It can help maintain the stable development of the corpus luteum and promote the synthesis and secretion of luteinizing hormone, thereby supporting the maintenance of pregnancy.
(4) Regulation of thyroid function: Choriogonadotropin alfa can affect thyroid function by stimulating thyroid cells to secrete thyroid hormone. This pathway of action is similar to that of HCG and can be used to assess the functional status of the thyroid.
The specific action pathway of Choriogonadotropin alfa is complex and diverse, and there are other subtle biological effects and influences. In addition, its pathway of action may be varied and regulated by different individuals and under different circumstances.

4. Research Status

There is currently only one formulation of Choriogonadotropin alfa approved by the FDA, Ovidrel (Choriogonadotropin alfa Injection) from Merck. The drug is a treatment used to promote follicular ovulation and is commonly used in infertility treatments. There is currently no record of FDA approval for other formulations of Choriogonadotropin alfa. However, not all drugs are on the path to FDA-approved commercialization, and many drugs and treatments are still under study and have not yet been approved by the FDA.