Choriogonadotropin alfa, Recombinant human chorionic gonadotropin

Specification

• Cat#: THP-0139
• Product Name: Choriogonadotropin alfa, Recombinant human chorionic gonadotropin
• Cas No: 177073-44-8
• Description: Recombinant human chorionic gonadotropin (Choriogonadotropin alfa) with 2 subunits, alpha = 92 a.a., beta = 145 a.a., each with N-and O-linked carbohydrate moieties linked to ASN-52 and ASN-78 (on alpha subunit) and ASN-13, ASN-30, SER-121, SER-127, SER-132 and SER-138 (on beta subunit). The primary structure of the alpha-chain of r-hCG is identical to that of the alpha-chain of hCG, FSH and LH.
• Sequences: APDVQDCPECTLQENPFFSQPGAPILQCMGCCFSRAYPTPLRSKKTMLVQKNVTSESTCCVAKSYNRVTVMGGFKVENHTACHCSTCYYHKSSKEPLRPRCRPINATLAVEKEGCPVCITVNTTICAGYCPTMTRVLQGVLPALPQVVCNYRDVRFESIRLPGCPRGVNPVVSYAVALSCQCALCRRSTTDCGGPKDHPLTCDDPRFQDSSSSKAPPPSLPSPSRLPGPSDTPILPQ
• Species: Human
• Molecular Weight: 25719.7 Da
• Purity: >99% by SDS-Page and HPLC analysis
• Formula: C1105H1770N318O336S26
• Endotoxin: <0.001 EU per 1 μg by the LAL method
• Biological Activity: 10000U/10mL
• Application: For the treatment of female infertility

Pharmaceutical Information

• Pharmaceutical Application: Choriogonadotropin alfa
• Targets: Target 1. Lutropin-choriogonadotropic hormone receptor; Target 2. Follicle-stimulating hormone receptor