0
Inquiry Basket
Check Out

Choriogonadotropin alfa, Recombinant human chorionic gonadotropin

Cat# : THP-0139

Product Datasheets COA :
Catalog# Product Name Availability Size Price Qty
THP-0139 Choriogonadotropin alfa, Recombinant human chorionic gonadotropin September 27, 2023 1 vial $3,998.00
Add to Cart Online Order Request a Bulk Order
Cat#:  THP-0139
Product Name:  Choriogonadotropin alfa, Recombinant human chorionic gonadotropin
Description:  Recombinant human chorionic gonadotropin (Choriogonadotropin alfa) with 2 subunits, alpha = 92 a.a., beta = 145 a.a., each with N-and O-linked carbohydrate moieties linked to ASN-52 and ASN-78 (on alpha subunit) and ASN-13, ASN-30, SER-121, SER-127, SER-132 and SER-138 (on beta subunit). The primary structure of the alpha-chain of r-hCG is identical to that of the alpha-chain of hCG, FSH and LH.
Sequences:  APDVQDCPECTLQENPFFSQPGAPILQCMGCCFSRAYPTPLRSKKTMLVQKNVTSESTCCVAKSYNRVTVMGGFKVENHTACHCSTCYYHKSSKEPLRPRCRPINATLAVEKEGCPVCITVNTTICAGYCPTMTRVLQGVLPALPQVVCNYRDVRFESIRLPGCPRGVNPVVSYAVALSCQCALCRRSTTDCGGPKDHPLTCDDPRFQDSSSSKAPPPSLPSPSRLPGPSDTPILPQ
Species:  Human
Molecular Weight:  25719.7 Da
Purity:  >99% by SDS-Page and HPLC analysis
Cas No:  177073-44-8
Formula:  C1105H1770N318O336S26
Endotoxin Level:  <0.001 EU per 1 μg by the LAL method
Biological Activity:  10000U/10mL
For research use only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.

Online Inquiry

  • Size: 100ug 500ug 1mg 5mg 10mg 100mg 500mg 1g
  • Conjugation: None R-PE APC Biotin FITC Alexa Flour Others
CONTACT US

For more information on how our products could help advance your project, please contact us.

Contact Us

ENTER YOUR EMAIL HERE TO SUBSCRIBE.

Copyright © 2023 Creative BioMart. All Rights Reserved.