0
Inquiry Basket
Check Out

Choriogonadotropin alfa, Recombinant human chorionic gonadotropin

Cat# : THP-0139

Cat#:  THP-0139
Product Name:  Choriogonadotropin alfa, Recombinant human chorionic gonadotropin
Description:  Recombinant human chorionic gonadotropin (Choriogonadotropin alfa) with 2 subunits, alpha = 92 a.a., beta = 145 a.a., each with N-and O-linked carbohydrate moieties linked to ASN-52 and ASN-78 (on alpha subunit) and ASN-13, ASN-30, SER-121, SER-127, SER-132 and SER-138 (on beta subunit). The primary structure of the alpha-chain of r-hCG is identical to that of the alpha-chain of hCG, FSH and LH.
Sequences:  APDVQDCPECTLQENPFFSQPGAPILQCMGCCFSRAYPTPLRSKKTMLVQKNVTSESTCCVAKSYNRVTVMGGFKVENHTACHCSTCYYHKSSKEPLRPRCRPINATLAVEKEGCPVCITVNTTICAGYCPTMTRVLQGVLPALPQVVCNYRDVRFESIRLPGCPRGVNPVVSYAVALSCQCALCRRSTTDCGGPKDHPLTCDDPRFQDSSSSKAPPPSLPSPSRLPGPSDTPILPQ
Species:  Human
Purity:  >99% by SDS-Page and HPLC analysis
Formula:  C1105H1770N318O336S26
EndotoxinLevel:  <0.001 EU per 1 μg by the LAL method
BiologicalActivity:  10000U/10mL
For research use only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.

Online Inquiry

  • Size: 100ug 500ug 1mg 5mg 10mg 100mg 500mg 1g
  • Conjugation: None R-PE APC Biotin FITC Alexa Flour Others
CONTACT US

For more information on how our products could help advance your project, please contact us.

Contact Us

ENTER YOUR EMAIL HERE TO SUBSCRIBE.

Copyright © 2022 Creative BioMart. All Rights Reserved.