Cat# : THP-0139
Catalog# | Product Name | Availability | Size | Price | Qty |
---|---|---|---|---|---|
THP-0139 | Choriogonadotropin alfa, Recombinant human chorionic gonadotropin | January 22, 2025 | 1 vial | $3,998.00 |
|
Add to Cart Online Order Request a Bulk Order |
Cat#: | THP-0139 |
Product Name: | Choriogonadotropin alfa, Recombinant human chorionic gonadotropin |
Cas No: | 177073-44-8 |
Description: | Recombinant human chorionic gonadotropin (Choriogonadotropin alfa) with 2 subunits, alpha = 92 a.a., beta = 145 a.a., each with N-and O-linked carbohydrate moieties linked to ASN-52 and ASN-78 (on alpha subunit) and ASN-13, ASN-30, SER-121, SER-127, SER-132 and SER-138 (on beta subunit). The primary structure of the alpha-chain of r-hCG is identical to that of the alpha-chain of hCG, FSH and LH. |
Sequences: | APDVQDCPECTLQENPFFSQPGAPILQCMGCCFSRAYPTPLRSKKTMLVQKNVTSESTCCVAKSYNRVTVMGGFKVENHTACHCSTCYYHKSSKEPLRPRCRPINATLAVEKEGCPVCITVNTTICAGYCPTMTRVLQGVLPALPQVVCNYRDVRFESIRLPGCPRGVNPVVSYAVALSCQCALCRRSTTDCGGPKDHPLTCDDPRFQDSSSSKAPPPSLPSPSRLPGPSDTPILPQ |
Species: | Human |
Molecular Weight: | 25719.7 Da |
Purity: | >99% by SDS-Page and HPLC analysis |
Formula: | C1105H1770N318O336S26 |
Endotoxin: | <0.001 EU per 1 μg by the LAL method |
Biological Activity: | 10000U/10mL |
Application: | For the treatment of female infertility |
For more information on how our products could help advance your project, please contact us.
ENTER YOUR EMAIL HERE TO SUBSCRIBE.
Copyright © 2025 Creative BioMart. All Rights Reserved.