Cat# : THP-0286
| Catalog# | Product Name | Availability | Size | Price | Qty |
|---|---|---|---|---|---|
| THP-0286 | Cenegermin, Recombinant Human Nerve Growth Factor (Beta Polypeptide) | February 09, 2026 | 1 vial | $3,998.00 |
|
| Add to Cart Online Order Request a Bulk Order |
| Cat#: | THP-0286 |
| Product Name: | Cenegermin, Recombinant Human Nerve Growth Factor (Beta Polypeptide) |
| Cas No: | 1772578-74-1 |
| Description: | A human beta-nerve growth factor (beta-ngf)-(1-118)- peptide (non-covalent dimer) produced in escherichia coli. |
| Sequences: | SSSHPIFHRGEFSVCDSVSVWVGDKTTATDIKGKEVMVLGEVNINNSVFKQYFFETKCRDPNPVDSGCRGIDSKHWNSYCTTTHTFVKALTMDGKQAAWRFIRIDTACVCVLSRKAVR |
| Species: | Human |
| Source: | E.coli |
| Purity: | >99% by SDS-Page and HPLC analysis |
| Formula: | C583H908N166O173S8 |
| Endotoxin: | <0.001 EU per 1 μg of the peptide by the LAL method |
| Storage: | Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 2-8 °C for 1 week. Aliquots of reconstituted samples are stable at < -20°C for 3 months. |
| Application: | Cenegermin is indicated for the treatment of moderate (persistent epithelial defect) or severe (corneal ulcer) neurotrophic keratitis in adults. |
For more information on how our products could help advance your project, please contact us.
ENTER YOUR EMAIL HERE TO SUBSCRIBE.
Copyright © 2026 Creative BioMart. All Rights Reserved.