0
Inquiry Basket
Quote

Cenegermin, Recombinant Human Nerve Growth Factor (Beta Polypeptide)

Cat# : THP-0286

Product Datasheets COA :
Catalog# Product Name Availability Size Price Qty
THP-0286 Cenegermin, Recombinant Human Nerve Growth Factor (Beta Polypeptide) March 01, 2024 1 vial $3,998.00
Add to Car Online Order Request a Bulk Order
Cat#:  THP-0286
Product Name:  Cenegermin, Recombinant Human Nerve Growth Factor (Beta Polypeptide)
Description:  A human beta-nerve growth factor (beta-ngf)-(1-118)- peptide (non-covalent dimer) produced in escherichia coli.
Sequences:  SSSHPIFHRGEFSVCDSVSVWVGDKTTATDIKGKEVMVLGEVNINNSVFKQYFFETKCRDPNPVDSGCRGIDSKHWNSYCTTTHTFVKALTMDGKQAAWRFIRIDTACVCVLSRKAVR
Species:  Human
Source:  E.coli
Purity:  >99% by SDS-Page and HPLC analysis
Cas No:  1772578-74-1
Formula:  C583H908N166O173S8
Endotoxin Level:  <0.001 EU per 1 μg of the peptide by the LAL method
Storage:  Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 2-8 °C for 1 week. Aliquots of reconstituted samples are stable at < -20°C for 3 months.
For research use only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
CONTACT US

For more information on how our products could help advance your project, please contact us.

Contact Us

ENTER YOUR EMAIL HERE TO SUBSCRIBE.

Copyright © 2024 Creative BioMart. All Rights Reserved.