Cenegermin, Recombinant Human Nerve Growth Factor (Beta Polypeptide)

Specification

• Cat#: THP-0286
• Product Name: Cenegermin, Recombinant Human Nerve Growth Factor (Beta Polypeptide)
• Cas No: 1772578-74-1
• Description: A human beta-nerve growth factor (beta-ngf)-(1-118)- peptide (non-covalent dimer) produced in escherichia coli.
• Sequences: SSSHPIFHRGEFSVCDSVSVWVGDKTTATDIKGKEVMVLGEVNINNSVFKQYFFETKCRDPNPVDSGCRGIDSKHWNSYCTTTHTFVKALTMDGKQAAWRFIRIDTACVCVLSRKAVR
• Species: Human
• Source: E.coli
• Purity: >99% by SDS-Page and HPLC analysis
• Formula: C583H908N166O173S8
• Endotoxin: <0.001 EU per 1 μg of the peptide by the LAL method
• Storage: Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 2-8 °C for 1 week. Aliquots of reconstituted samples are stable at < -20°C for 3 months.
• Application: Cenegermin is indicated for the treatment of moderate (persistent epithelial defect) or severe (corneal ulcer) neurotrophic keratitis in adults.

Pharmaceutical Information

• Pharmaceutical Application: Cenegermin
• Targets: High affinity nerve growth factor receptor