0
Inquiry Basket
Check Out

Atacicept, Recombinant Human TACI/TNFRSF13B Protein

Cat# : THP-0200

Product Datasheets COA :
Catalog# Product Name Availability Size Price Qty
THP-0200 Atacicept, Recombinant Human TACI/TNFRSF13B Protein September 27, 2023 1 vial $3,998.00
Add to Cart Online Order Request a Bulk Order
Cat#:  THP-0200
Product Name:  Atacicept, Recombinant Human TACI/TNFRSF13B Protein
Description:  The product is a recombinant fusion protein combined with the extracellular ligand binding portion of TACI, FUSION-TNFRSF13B-GAMMA-1 (TNFRSF13B(Pr30-110)(1-81)+HINGE-REGION(82-96)+CH2(97-206)+CH3(207-313).
Sequences:  AMRSCPEEQYWDPLLGTCMSCKTICNHQSQRTCAAFCRSLSCRKEQGKFYDHLLRDCISCASICGQHPKQCAYFCENKLRSEPKSSDKTHTCPPCPAPEAEGAPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPSSIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
Species:  Human
Molecular Weight:  70707.2547 Da
Purity:  >95% by SDS-Page and HPLC analysis
Cas No:  845264-92-8
Formula:  Not Available
Endotoxin Level:  <0.1 EU per 1 μg of the peptide by the LAL method
Storage:  Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 2-8 °C for 1 week. Aliquots of reconstituted proteins are stable at < -20°C for 3 months.
For research use only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.

Online Inquiry

  • Size: 100ug 500ug 1mg 5mg 10mg 100mg 500mg 1g
  • Conjugation: None R-PE APC Biotin FITC Alexa Flour Others
CONTACT US

For more information on how our products could help advance your project, please contact us.

Contact Us

ENTER YOUR EMAIL HERE TO SUBSCRIBE.

Copyright © 2023 Creative BioMart. All Rights Reserved.