Atacicept, Recombinant Human TACI/TNFRSF13B Protein

Specification

• Cat#: THP-0200
• Product Name: Atacicept, Recombinant Human TACI/TNFRSF13B Protein
• Cas No: 845264-92-8
• Description: The product is a recombinant fusion protein combined with the extracellular ligand binding portion of TACI, FUSION-TNFRSF13B-GAMMA-1 (TNFRSF13B(Pr30-110)(1-81)+HINGE-REGION(82-96)+CH2(97-206)+CH3(207-313).
• Sequences: AMRSCPEEQYWDPLLGTCMSCKTICNHQSQRTCAAFCRSLSCRKEQGKFYDHLLRDCISCASICGQHPKQCAYFCENKLRSEPKSSDKTHTCPPCPAPEAEGAPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPSSIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
• Species: Human
• Molecular Weight: 70707.2547 Da
• Purity: >95% by SDS-Page and HPLC analysis
• Formula: Not Available
• Endotoxin: <0.1 EU per 1 μg of the peptide by the LAL method
• Storage: Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 2-8 °C for 1 week. Aliquots of reconstituted proteins are stable at < -20°C for 3 months.
• Application: Investigated for use/treatment in autoimmune diseases, systemic lupus erythematosus, rheumatoid arthritis, multiple myeloma, lymphoma (non-hodgkin's), and leukemia (lymphoid).

Pharmaceutical Information

• Pharmaceutical Application: Atacicept