Cat# : THP-0200
| Catalog# | Product Name | Availability | Size | Price | Qty |
|---|---|---|---|---|---|
| THP-0200 | Atacicept, Recombinant Human TACI/TNFRSF13B Protein | December 25, 2025 | 1 vial | $3,998.00 |
|
| Add to Cart Online Order Request a Bulk Order |
| Cat#: | THP-0200 |
| Product Name: | Atacicept, Recombinant Human TACI/TNFRSF13B Protein |
| Cas No: | 845264-92-8 |
| Description: | The product is a recombinant fusion protein combined with the extracellular ligand binding portion of TACI, FUSION-TNFRSF13B-GAMMA-1 (TNFRSF13B(Pr30-110)(1-81)+HINGE-REGION(82-96)+CH2(97-206)+CH3(207-313). |
| Sequences: | AMRSCPEEQYWDPLLGTCMSCKTICNHQSQRTCAAFCRSLSCRKEQGKFYDHLLRDCISCASICGQHPKQCAYFCENKLRSEPKSSDKTHTCPPCPAPEAEGAPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPSSIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK |
| Species: | Human |
| Molecular Weight: | 70707.2547 Da |
| Purity: | >95% by SDS-Page and HPLC analysis |
| Formula: | Not Available |
| Endotoxin: | <0.1 EU per 1 μg of the peptide by the LAL method |
| Storage: | Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 2-8 °C for 1 week. Aliquots of reconstituted proteins are stable at < -20°C for 3 months. |
| Application: | Investigated for use/treatment in autoimmune diseases, systemic lupus erythematosus, rheumatoid arthritis, multiple myeloma, lymphoma (non-hodgkin's), and leukemia (lymphoid). |
For more information on how our products could help advance your project, please contact us.
ENTER YOUR EMAIL HERE TO SUBSCRIBE.
Copyright © 2025 Creative BioMart. All Rights Reserved.