0
Inquiry Basket
Quote

Ancestim, Recombinant human stem cell factor

Cat# : THP-0047

Product Datasheets COA :
Catalog# Product Name Availability Size Price Qty
THP-0047 Ancestim, Recombinant human stem cell factor October 10, 2025 1 vial $3,998.00
Add to Cart Online Order Request a Bulk Order
Cat#:  THP-0047
Product Name:  Ancestim, Recombinant human stem cell factor
Cas No:  163545-26-4
Description:  The product is a non-glycosylated recombinant methionyl human stem cell factor. It is a 166 amino acid protein produced by E. coli with an amino acid sequence that is identical to the natural sequence predicted from human DNA sequence analysis, except for the addition of an N-terminal methionine.
Sequences:  MEGICRNRVTNNVKDVTKLVANLPKDYMITLKYVPGMDVLPSHCWISEMVVQLSDSLTDLLDKFSNISEGLSNYSIIDKLVNIVDDLVECVKENSSKDLKKSFKSPEPRLFTPEEFFRIFNRSIDAFKDFVVASETSDCVVSSTLSPEKDSRVSVTKPFMLPPVA
Species:  Human
Molecular Weight:  18540.0 Da (non-glycosylated)
Source:  E.coli
Purity:  >99% by SDS-Page and HPLC analysis
Formula:  C1662H2650N422O512S18
Endotoxin:  <0.001 EU per 1 μg of the peptide by the LAL method
Storage:  Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 2-8 °C for 1 week. Aliquots of reconstituted samples are stable at < -20°C for 3 months.
Application:  The product, in combination with filgrastim, is indicated for the setting of autologous peripheral blood progenitor cell transplantation in patients at risk of poor peripheral blood progenitor cell mobilisation. The use of ancestim with filgrastim will generate a sustained increase in the number of peripheral blood progenitor cells capable of engraftment. It is used for mobilization of progenitor cells from the bone marrow to the peripheral blood with or withouth mobilizing chemotherapy. The harvested progenitor cells can be used for transplant following myelosuppressive or myeloablative therapies.
Not For Human Consumption!

Online Inquiry

  • Size: 100ug 500ug 1mg 5mg 10mg 100mg 500mg 1g
  • Conjugation: None R-PE APC Biotin FITC Alexa Flour Others
CONTACT US

For more information on how our products could help advance your project, please contact us.

Contact Us

ENTER YOUR EMAIL HERE TO SUBSCRIBE.

Copyright © 2025 Creative BioMart. All Rights Reserved.