0
Inquiry Basket
Quote

Anakinra, Recombinant Human IL1Ra

Cat# : THP-0110

Product Datasheets COA :
Catalog# Product Name Availability Size Price Qty
THP-0110 Anakinra, Recombinant Human IL1Ra May 09, 2025 1mg $998.00
10mg $3,998.00
Add to Cart Online Order Request a Bulk Order
Cat#:  THP-0110
Product Name:  Anakinra, Recombinant Human IL1Ra
Cas No:  143090-92-0
Description:  The product is a recombinant, nonglycosylated human interleukin-1 receptor antagonist (IL-1Ra). The difference between the product and the native human IL-1Ra is that the product has an extra methionine residue at the amino terminus. It is manufactured by using the E. coli expression system. The product is composed of 153 amino acid residues.
Sequences:  MRPSGRKSSKMQAFRIWDVNQKTFYLRNNQLVAGYLQGPNVNLEEKIDVVPIEPHALFLGIHGGKMCLSCVKSGDETRLQLEAVNITDLSENRKQDKRFAFIRSDSGPTTSFESAACPGWFLCTAMEADQPVSLTNMPDEGVMVTKFYFQEDE
Species:  Human
Molecular Weight:  17257.6 Da
Source:  E. coli
Purity:  >99% by SDS-Page and HPLC analysis
Formula:  C759H1186N208O232S10
Endotoxin:  <0.001 EU per 1 μg of the peptide by the LAL method
Storage:  Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 2-8 °C for 1 week. Aliquots of reconstituted samples are stable at < -20°C for 3 months.
Application:  For the treatment of adult rheumatoid arthritis and treatment of Neonatal-Onset Multisystem Inflammatory Disease (NOMID).
Concentration:  150 mg / mL
Not For Human Consumption!

Online Inquiry

  • Size: 100ug 500ug 1mg 5mg 10mg 100mg 500mg 1g
  • Conjugation: None R-PE APC Biotin FITC Alexa Flour Others
CONTACT US

For more information on how our products could help advance your project, please contact us.

Contact Us

ENTER YOUR EMAIL HERE TO SUBSCRIBE.

Copyright © 2025 Creative BioMart. All Rights Reserved.