Cat# : THP-0110
Catalog# | Product Name | Availability | Size | Price | Qty |
---|---|---|---|---|---|
THP-0110 | Anakinra, Recombinant Human IL1Ra | July 26, 2025 | 1mg | $998.00 |
|
10mg | $3,998.00 |
|
Add to Cart Online Order Request a Bulk Order |
Cat#: | THP-0110 |
Product Name: | Anakinra, Recombinant Human IL1Ra |
Cas No: | 143090-92-0 |
Description: | The product is a recombinant, nonglycosylated human interleukin-1 receptor antagonist (IL-1Ra). The difference between the product and the native human IL-1Ra is that the product has an extra methionine residue at the amino terminus. It is manufactured by using the E. coli expression system. The product is composed of 153 amino acid residues. |
Sequences: | MRPSGRKSSKMQAFRIWDVNQKTFYLRNNQLVAGYLQGPNVNLEEKIDVVPIEPHALFLGIHGGKMCLSCVKSGDETRLQLEAVNITDLSENRKQDKRFAFIRSDSGPTTSFESAACPGWFLCTAMEADQPVSLTNMPDEGVMVTKFYFQEDE |
Species: | Human |
Molecular Weight: | 17257.6 Da |
Source: | E. coli |
Purity: | >99% by SDS-Page and HPLC analysis |
Formula: | C759H1186N208O232S10 |
Endotoxin: | <0.001 EU per 1 μg of the peptide by the LAL method |
Storage: | Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 2-8 °C for 1 week. Aliquots of reconstituted samples are stable at < -20°C for 3 months. |
Application: | For the treatment of adult rheumatoid arthritis and treatment of Neonatal-Onset Multisystem Inflammatory Disease (NOMID). |
Concentration: | 150 mg / mL |
For more information on how our products could help advance your project, please contact us.
ENTER YOUR EMAIL HERE TO SUBSCRIBE.
Copyright © 2025 Creative BioMart. All Rights Reserved.