Anakinra, Recombinant Human IL1Ra

Specification

• Cat#: THP-0110
• Product Name: Anakinra, Recombinant Human IL1Ra
• Description: The product is a recombinant, nonglycosylated human interleukin-1 receptor antagonist (IL-1Ra). The difference between the product and the native human IL-1Ra is that the product has an extra methionine residue at the amino terminus. It is manufactured by using the E. coli expression system. The product is composed of 153 amino acid residues.
• Sequences: MRPSGRKSSKMQAFRIWDVNQKTFYLRNNQLVAGYLQGPNVNLEEKIDVVPIEPHALFLGIHGGKMCLSCVKSGDETRLQLEAVNITDLSENRKQDKRFAFIRSDSGPTTSFESAACPGWFLCTAMEADQPVSLTNMPDEGVMVTKFYFQEDE
• Species: Human
• Molecular Weight: 17257.6 Da
• Source: E. coli
• Purity: >99% by SDS-Page and HPLC analysis
• Cas No: 143090-92-0
• Formula: C759H1186N208O232S10
• Endotoxin Level: <0.001 EU per 1 μg of the peptide by the LAL method
• Biological Activity: 150 mg / mL
• Storage: Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 2-8 °C for 1 week. Aliquots of reconstituted samples are stable at < -20°C for 3 months.

Pharmaceutical Information

• Pharmaceutical Application: Anakinra
• Applications: For the treatment of adult rheumatoid arthritis and treatment of Neonatal-Onset Multisystem Inflammatory Disease (NOMID).
• Examples of Clinical Use: Adult rheumatoid arthritis and Neonatal-Onset Multisystem Inflammatory Disease (NOMID)
• Pharmacodynamics: Used to treat rheumatoid arthritis, The product blocks the biologic activity of IL-1 by competitively inhibiting IL-1 binding to the interleukin-1 type I receptor (IL-1RI), which is expressed in a wide variety of tissues and organs. IL-1 production is induced in response to inflammatory stimuli and mediates various physiologic responses including inflammatory and immunological responses. Patients with rheumatoid arthritis have elevated levels of IL-1. The levels of the naturally occurring IL-1Ra in synovium and synovial fluid from rheumatoid arthritis (RA) patients are not sufficient to compete with the elevated amount of locally produced IL-1. Increasing the levels of IL-1Ra by artificial means reduces the negative effects (cartilage degradation, bone resorption) of IL-1.
• Mechanism of action: Anakinra binds competitively to the Interleukin-1 type I receptor (IL-1RI), thereby inhibiting the action of elevated levels IL-1 which normally can lead to cartilage degradation and bone resorption.
• Affected organisms: Humans and other mammals
• Targets: Target 1. Interleukin-1 receptor type 1