Alfimeprase, Recombinant fibrolase

Specification

• Cat#: THP-0203
• Product Name: Alfimeprase, Recombinant fibrolase
• Cas No: 259074-76-5
• Description: The product is a recombinant analog of fibrolase. Fibrolase is a zinc-containing metalloproteinase isolated from the venom of the southern copperhead snake (Agkistrodon contortrix contortrix). It is a small protein that contains 203 residues.
• Sequences: SFPQRYVQLVIVADHRMNTKYNGDSDKIRQWVHQIVNTINEIYRPLNIQFTLVGLEIWSNQDLITVTSVSHDTLASFGNWRETDLLRRQRHDNAQLLTAIDFDGDTVGLAYVGGMCQLKHSTGVIQDHSAINLLVALTMAHELGHNLGMNHDGNQCHCGANSCVMAAMLSDQPSKLFSDCSKKDYQTFLTVNNPQCILNKP
• Species: Agkistrodon contortrix contortrix
• Molecular Weight: Not Available
• Purity: >99% by SDS-Page and HPLC analysis
• Formula: Not Available
• Endotoxin: <0.1 EU per 1 μg of the protein by the LAL method
• Storage: Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 2-8 °C for 1 week. Aliquots of reconstituted samples are stable at < -20°C for 3 months.
• Application: The product is being evaluated as a potential treatment for acute ischemic stroke, catheter occlusion (CO) and acute peripheral arterial occlusion (PAO).

Pharmaceutical Information

• Pharmaceutical Application: Alfimeprase
• Targets: Target 1. Fibrinogen alpha chain; Target 2. Fibrinogen beta chain.

Related Reading

Background of Alfimeprase

Alfimeprase protein is a protease introduced by Nuvelo in 2007, used to treat thrombotic diseases. The protease is a kind of thrombotic Plasmin, which can directly cut off the agglutination point in the original molecular structure of fibrin, so that the thrombus can be relieved.

Function of Alfimeprase

Alfimeprase protein plays an important role in the treatment of thrombotic diseases. Specifically, it can promote the dissolution of thrombi by breaking down fibrin in the thrombus. In addition, it can also promote the activation of fibrinogen, thereby preventing thrombosis.

Alfimeprase is a protease obtained from protein analysis and has a broad spectrum of fibrinolytic activity. It can not only degrade fibrinogen, but also break down proteins related to platelet aggregation, thus exerting a strong thrombolytic effect.

The difference between Alfimeprase and fibrolase is that they exhibit different activities for different types of thrombi. Fibrolase is mainly involved in the degradation of cellulose thrombus, while Alfimeprase is more suitable for the dissolution of platelet thrombus. This means that the two have irreplaceable advantages in the treatment of different types of thrombosis.

Alfimeprase related signaling pathways

The activity of Alfimeprase is mainly transmitted through the activation of the kininogen additive pathway. The kininogen additive pathway is a complex signal pathway that plays an important role in the vascular system. It can promote vasodilation, reduce blood pressure and promote the dissolution of thrombosis by regulating the function of endothelial cells.

Alfimeprase related diseases

Alfimeprase protein can be used to treat thrombotic diseases, including deep vein thrombosis, pulmonary thromboembolism and arteriovenous thrombosis.

Potential applications in medicine

In addition to treating thrombotic diseases, Alfimeprase also has potential medical applications. For example, Alfimeprase also has a broad application prospect in the treatment of gastrointestinal ulcer, hypertension, lung cancer, liver cancer, pancreatic cancer and other malignant tumors.

Alfimeprase protein related drugs under development

Due to the importance of Alfimeprase in medicine, people are actively searching for new similar proteins to further explore the potential applications of Alfimeprase proteins. At present, some drugs under research have been confirmed to be related to the Alfimeprase protein, including:

AR-101: This is a selective Alfimeprase inhibitor, which can be used to treat Deep vein thrombosis and other Alfimeprase related diseases.

AZX100: This is a biotechnology product based on Alfimeprase protein, which can be used to treat stubborn fibrous tissue and diseases such as psoriasis.

RB006: This is an antibody drug that can inhibit the activity of Alfimeprase protein and reduce the formation and expansion of blood clots.