0
Inquiry Basket
Check Out

Tetanus immune globulin(Human)

Cat# : THP-0170

Product Datasheets COA :
Catalog# Product Name Availability Size Price Qty
THP-0170 Tetanus immune globulin(Human) September 28, 2023 25U $998.00
Add to Cart Online Order Request a Bulk Order
THP-0170 Tetanus immune globulin(Human) September 28, 2023 125U $3,998.00
Add to Cart Online Order Request a Bulk Order
Cat#:  THP-0170
Product Name:  Tetanus immune globulin(Human)
Description:  The product is manufactured from human plasma, contains antibodies against tetanus toxoid and is primarily used as prophylaxis against tetanus.
Sequences:  SEQUENCEEVQLVESGGGVVQPGRSLRLSCAASGFTFNNYAIHWVRQAPGKGLEWVAFISYDGSKNYYADSVKGRFTISRDNSKNTLFLQMNSLRPEDTAIYYCARVLFQQLVLYAPFDIWGQGTMVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPQPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSC
Species:  Human
Molecular Weight:  Not Available
Source:  Human Plasma
Cas No:  Not Available
Formula:  Not Available
Endotoxin Level:  <0.001 EU per 1 μg of the peptide by the LAL method
Biological Activity:  250IU/ml
For research use only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.

Online Inquiry

  • Size: 100ug 500ug 1mg 5mg 10mg 100mg 500mg 1g
  • Conjugation: None R-PE APC Biotin FITC Alexa Flour Others
CONTACT US

For more information on how our products could help advance your project, please contact us.

Contact Us

ENTER YOUR EMAIL HERE TO SUBSCRIBE.

Copyright © 2023 Creative BioMart. All Rights Reserved.