Sargramostim; GM-CSF

Specification

• Cat#: THP-0003
• Product Name: Sargramostim; GM-CSF
• Cas No: 123774-72-1
• Description: A modified form of recombinant human granulocyte macrophage colony-stimulating factor (GM-CSF) expressed in yeast. It is a glycoprotein that is 127 residues. Substitution of Leu23 leads to a difference from native protein.
• Sequences: APARSPSPSTQPWEHVNAIQEALRLLNLSRDTAAEMNETVEVISEMFDLQEPTCLQTRLELYKQGLRGSLTKLKGPLTMMASHYKQHCPPTPETSCATQIITFESFKENLKDFLLVIPFDCWEPVQE
• Species: Human
• Molecular Weight: 14434.5 Da
• Source: Yeast
• Purity: >99% by SDS-Page and HPLC analysis
• Formula: C639H1006N168O196S8
• Endotoxin: <0.001 EU per 1 μg of the protein by the LAL method
• Application: For the treatment of cancer and bone marrow transplant.
• Concentration: 500 ug/1mL

Pharmaceutical Information

• Pharmaceutical Application: Sargramostim
• Targets: Target 1. Granulocyte-macrophage colony-stimulating factor receptor subunit alpha; Target 2. Interleukin-3 receptor subunit alpha; Target 3. Cytokine receptor common subunit beta; Target 4. Syndecan-2; Target 5. Bone marrow proteoglycan