Sargramostim; GM-CSF

0

Inquiry Basket

Search

Home
Sargramostim; GM-CSF

Sargramostim; GM-CSF

Cat# : THP-0003

Product Datasheets COA :

Specification Drug Information Related Products

Cat#:	THP-0003
Product Name:	Sargramostim; GM-CSF
Description:	A modified form of recombinant human granulocyte macrophage colony-stimulating factor (GM-CSF) expressed in yeast. It is a glycoprotein that is 127 residues. Substitution of Leu23 leads to a difference from native protein.
Sequences:	APARSPSPSTQPWEHVNAIQEALRLLNLSRDTAAEMNETVEVISEMFDLQEPTCLQTRLELYKQGLRGSLTKLKGPLTMMASHYKQHCPPTPETSCATQIITFESFKENLKDFLLVIPFDCWEPVQE
Species:	Human
Molecular Weight:	14434.5 Da
Source:	Yeast
Purity:	>99% by SDS-Page and HPLC analysis
Cas No:	123774-72-1
Formula:	C639H1006N168O196S8
Endotoxin Level:	<0.001 EU per 1 μg of the protein by the LAL method
Biological Activity:	500 ug/1mL

Catalog#	Product Name	Size	Price	Inquiry
THP-0004	Talimogene laherparepvec; T-Vec			Inquiry
THP-0005	Thyrotropin alfa; Recombinant thyroid stimulating hormone			Inquiry
THP-0009	Keyhole limpet hemocyanin(KLH)	1mg	$2,998	Add to CartOrder

For research use only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.

CONTACT US

For more information on how our products could help advance your project, please contact us.

Contact Us

ENTER YOUR EMAIL HERE TO SUBSCRIBE.

Drug Name:	Sargramostim
Applications:	For the treatment of cancer and bone marrow transplant.
Examples of Clinical Use:	Cancer and bone marrow transplant
Pharmacodynamics:	The product is used in the treatment of bone marrow transplant recipients or those exposed to chemotherapy an recovering from acut myelogenous leukemia, GM-CSF is a hematopoietic growth factor which stimulates the survival, clonal expansion (proliferation) and differentiation of hematopoietic progenitor cells. GM-CSF is also capable of activating mature granulocytes and macrophages. After a bone marrow transplant or chemotherapy, patients have a reduced capacity to produce red and white blood cells. Supplementing them with external sources of GM-CSF helps bring the level of neutrophils back to normal so that they can better fight infections.
Mechanism of action:	Sargramostim binds to the Granulocyte-macrophage colony stimulating factor receptor (GM-CSF-R-alpha or CSF2R) which stimulates a JAK2 STAT1/STAT3 signal transduction pathway. This leads to the production of hemopoietic cells and neutrophils.
Affected organisms:	Humans and other mammals
Targets:	Target 1. Granulocyte-macrophage colony-stimulating factor receptor subunit alpha; Target 2. Interleukin-3 receptor subunit alpha; Target 3. Cytokine receptor common subunit beta; Target 4. Syndecan-2; Target 5. Bone marrow proteoglycan

Sargramostim; GM-CSF

Sargramostim; GM-CSF

Online Inquiry