0
Inquiry Basket
Quote

Sargramostim; GM-CSF

Cat# : THP-0003

Product Datasheets COA :
Catalog# Product Name Availability Size Price Qty
THP-0003 Sargramostim; GM-CSF March 01, 2024 250ug $2,998.00
Add to Car Online Order Request a Bulk Order
Cat#:  THP-0003
Product Name:  Sargramostim; GM-CSF
Description:  A modified form of recombinant human granulocyte macrophage colony-stimulating factor (GM-CSF) expressed in yeast. It is a glycoprotein that is 127 residues. Substitution of Leu23 leads to a difference from native protein.
Sequences:  APARSPSPSTQPWEHVNAIQEALRLLNLSRDTAAEMNETVEVISEMFDLQEPTCLQTRLELYKQGLRGSLTKLKGPLTMMASHYKQHCPPTPETSCATQIITFESFKENLKDFLLVIPFDCWEPVQE
Species:  Human
Molecular Weight:  14434.5 Da
Source:  Yeast
Purity:  >99% by SDS-Page and HPLC analysis
Cas No:  123774-72-1
Formula:  C639H1006N168O196S8
Endotoxin Level:  <0.001 EU per 1 μg of the protein by the LAL method
Biological Activity:  500 ug/1mL
For research use only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
CONTACT US

For more information on how our products could help advance your project, please contact us.

Contact Us

ENTER YOUR EMAIL HERE TO SUBSCRIBE.

Copyright © 2024 Creative BioMart. All Rights Reserved.