0
Inquiry Basket
Quote

Rasburicase, Recombinant urate-oxidase enzyme

Cat# : THP-0091

Product Datasheets COA :
Catalog# Product Name Availability Size Price Qty
THP-0091 Rasburicase, Recombinant urate-oxidase enzyme March 01, 2024 1 vial $3,998.00
Add to Car Online Order Request a Bulk Order
Cat#:  THP-0091
Product Name:  Rasburicase, Recombinant urate-oxidase enzyme
Description:  The product is a recombinant urate-oxidase enzyme produced by a genetically modified Saccharomyces cerevisiae strain. The cDNA coding was cloned from a strain of Aspergillus flavus.
Sequences:  SAVKAARYGKDNVRVYKVHKDEKTGVQTVYEMTVCVLLEGEIETSYTKADNSVIVATDSIKNTIYITAKQNPVTPPELFGSILGTHFIEKYNHIHAAHVNIVCHRWTRMDIDGKPHPHSFIRDSEEKRNVQVDVVEGKGIDIKSSLSGLTVLKSTNSQFWGFLRDEYTTLKETWDRILSTDVDATWQWKNFSGLQEVRSHVPKFDATWATAREVTLKTFAEDNSASVQATMYKMAEQILARQQLIETVEYSLPNKHYFEIDLSWHKGLQNTGKNAEVFAPQSDPNGLIKCTVGRSSLKSKL
Species:  Aspergillus flavus
Molecular Weight:  34109.5 Da
Source:  Saccharomyces cerevisiae
Purity:  >99% by SDS-Page and HPLC analysis
Cas No:  134774-45-1
Formula:  C1521H2381N417O461S7
Endotoxin Level:  <0.001 EU per 1 μg by the LAL method
Biological Activity:  7.5 mg/5mL
For research use only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
CONTACT US

For more information on how our products could help advance your project, please contact us.

Contact Us

ENTER YOUR EMAIL HERE TO SUBSCRIBE.

Copyright © 2024 Creative BioMart. All Rights Reserved.