0
Inquiry Basket
Quote

Pineapple stem bromelain

Cat# : THP-0153

Product Datasheets COA :
Catalog# Product Name Availability Size Price Qty
THP-0153 Pineapple stem bromelain January 22, 2025 5g $298.00
1Kg $3,998.00
Add to Cart Online Order Request a Bulk Order
Cat#:  THP-0153
Product Name:  Pineapple stem bromelain
Cas No:  37189-34-7
Description:  Bromelain is a category of protein-digesting enzymes that are obtained from the fruit or stem of pineapples. Although both fruit bromelain are prepared differently and contain different enzymatic compositions. Bromelain is consequently a composite mixture of several different endopeptidases that can facilitate many different reactions with many different substrates.
Sequences:  AVPQSIDWRDYGAVTSVKNQNPCGACWAFAAIATVESIYKIKKGILEPLSEQQVLDCAKGYGCKGGWEFRAFEFIISNKGVASGAIYPYKAAKGTCKTDGVPNSAYITGYARVPRNNESSMMYAVSKQPITVAVDANANFQYYKSGVFNGPCGTSLNHAVTAIGYGQDSIIYPKKWGAKWGEAGYIRMARDVSSSSGICGIAIDPLYPTLEE
Species:  Pineapples
Molecular Weight:  Not Available
Formula:  Not Available
Endotoxin:  <0.001 EU per 1 μg of the peptide by the LAL method
Application:  The primary medical purpose for which the product is currently indicated for is the removal of eschar in adults with deep partial- and full-thickness thermal burns. Besides this official indication, however, it is also believed that SB may be used as a treatment for several other purposes as well, including cardiovascular health, osteoarthritis, autoimmunity, blood clotting, diarrhea, cancer, surgery, and debridement - although the specific mechanisms of action for these indications remain to be elucidated.
Not For Human Consumption!

Online Inquiry

  • Size: 100ug 500ug 1mg 5mg 10mg 100mg 500mg 1g
  • Conjugation: None R-PE APC Biotin FITC Alexa Flour Others
CONTACT US

For more information on how our products could help advance your project, please contact us.

Contact Us

ENTER YOUR EMAIL HERE TO SUBSCRIBE.

Copyright © 2025 Creative BioMart. All Rights Reserved.