0
Inquiry Basket
Quote

Pineapple stem bromelain

Cat# : THP-0153

Product Datasheets COA :
Catalog# Product Name Availability Size Price Qty
THP-0153 Pineapple stem bromelain March 01, 2024 5g $298.00
Add to Car Online Order Request a Bulk Order
THP-0153 Pineapple stem bromelain March 01, 2024 1Kg $3,998.00
Add to Car Online Order Request a Bulk Order
Cat#:  THP-0153
Product Name:  Pineapple stem bromelain
Description:  Bromelain is a category of protein-digesting enzymes that are obtained from the fruit or stem of pineapples. Although both fruit bromelain are prepared differently and contain different enzymatic compositions. Bromelain is consequently a composite mixture of several different endopeptidases that can facilitate many different reactions with many different substrates.
Sequences:  AVPQSIDWRDYGAVTSVKNQNPCGACWAFAAIATVESIYKIKKGILEPLSEQQVLDCAKGYGCKGGWEFRAFEFIISNKGVASGAIYPYKAAKGTCKTDGVPNSAYITGYARVPRNNESSMMYAVSKQPITVAVDANANFQYYKSGVFNGPCGTSLNHAVTAIGYGQDSIIYPKKWGAKWGEAGYIRMARDVSSSSGICGIAIDPLYPTLEE
Species:  Pineapples
Molecular Weight:  Not Available
Cas No:  37189-34-7
Formula:  Not Available
Endotoxin Level:  <0.001 EU per 1 μg of the peptide by the LAL method
For research use only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
CONTACT US

For more information on how our products could help advance your project, please contact us.

Contact Us

ENTER YOUR EMAIL HERE TO SUBSCRIBE.

Copyright © 2024 Creative BioMart. All Rights Reserved.