Pineapple stem bromelain

Specification

• Cat#: THP-0153
• Product Name: Pineapple stem bromelain
• Cas No: 37189-34-7
• Description: Bromelain is a category of protein-digesting enzymes that are obtained from the fruit or stem of pineapples. Although both fruit bromelain are prepared differently and contain different enzymatic compositions. Bromelain is consequently a composite mixture of several different endopeptidases that can facilitate many different reactions with many different substrates.
• Sequences: AVPQSIDWRDYGAVTSVKNQNPCGACWAFAAIATVESIYKIKKGILEPLSEQQVLDCAKGYGCKGGWEFRAFEFIISNKGVASGAIYPYKAAKGTCKTDGVPNSAYITGYARVPRNNESSMMYAVSKQPITVAVDANANFQYYKSGVFNGPCGTSLNHAVTAIGYGQDSIIYPKKWGAKWGEAGYIRMARDVSSSSGICGIAIDPLYPTLEE
• Species: Pineapples
• Molecular Weight: Not Available
• Formula: Not Available
• Endotoxin: <0.001 EU per 1 μg of the peptide by the LAL method
• Application: The primary medical purpose for which the product is currently indicated for is the removal of eschar in adults with deep partial- and full-thickness thermal burns. Besides this official indication, however, it is also believed that SB may be used as a treatment for several other purposes as well, including cardiovascular health, osteoarthritis, autoimmunity, blood clotting, diarrhea, cancer, surgery, and debridement - although the specific mechanisms of action for these indications remain to be elucidated.

Pharmaceutical Information

• Pharmaceutical Application: Stem bromelain